KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_00655Help
Entry
KPNIH30_00655     CDS       T03466                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_00655
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_00655
Enzymes [BR:kpw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     KPNIH30_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_7 AdoHcyase_NAD F420_oxidored ApbA
Motif
Other DBs
NCBI-ProteinID: AIX76810
UniProt: A0A422YH73
Position
136741..138216
Genome map
AA seq 491 aa AA seqDB search
MANYFNTLNLRQQLAQLGKCRFMARDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDSG
LDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDKQHSDVVRSVQP
LMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVL
MIAMVKAGVELAFETMVASGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFSYACVPLLKEFMTTLQTGDLGTAIAEGAVDNAQLRDVNEAIRSHAIEQVGKKLRGY
MTDMKRIAVAG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggctaactactttaatacactgaacctgcgccagcagctggcacagctgggcaaatgc
cgctttatggcgcgcgacgaattcgccgatggcgcaagctaccttcagggtaaaaaagtg
gtcatcgtcggctgcggcgcacagggcctgaaccagggtctgaacatgcgtgactccggc
ctggatatctcctatgcgctgcgtaaagaagcgatcgctgagaagcgcgcctcctggcgt
aaagcgactgaaaacggcttcaaagtcggcacttatgaagagctgatcccgcaggccgac
ctggtggttaacctgacgccggacaaacagcactcagacgttgtgcgctccgtacagccg
ctgatgaaagacggcgcagcgctgggttactcccacggcttcaacatcgtggaagtgggc
gagcagatccgtaaagacatcaccgtggtgatggtggcgccgaagtgcccgggcaccgaa
gtgcgtgaagagtacaaacgcggtttcggcgtaccgacgcttatcgcggtacacccggaa
aacgacccgaaaggcgaaggcatggcgattgccaaagcatgggctgcggcgacaggcggc
caccgcgcgggcgtgctggagtcttccttcgtggcggaagtgaaatctgacctgatgggc
gagcaaaccatcctttgcggcatgctgcaggcgggttctctgctgtgcttcgacaagctg
gtggcggaaggtaccgatccggcgtatgcagaaaaactgattcagttcggctgggaaacc
atcaccgaagcgctgaagcagggcggcatcaccctgatgatggatcgcctctccaacccg
gcgaaactgcgcgcttatgcgctgtccgagcagctgaaagagatcatggcgccgctgttc
cagaaacacatggacgacatcatctccggcgaattctcctccggtatgatggcggactgg
gcgaatgatgataagaaactgctgacctggcgtgaagagaccggcaaaaccgccttcgaa
accgcgccgcaatatgaaggcaaaatcggcgagcaggagtacttcgataaaggcgttctg
atgatcgcgatggtgaaagcgggcgttgagctggccttcgaaaccatggtggcctccggc
atcatcgaagagtctgcttactacgaatcactgcatgagctgccgcttatcgccaacacc
atcgcccgtaagcgtctgtatgagatgaacgtggttatttccgataccgctgaatatggt
aactacctgttctcttacgcttgcgtaccgctgctgaaagagttcatgaccaccctgcag
accggcgacctgggcacagcgattgccgaaggcgcggtagataacgcgcagctgcgcgat
gtgaacgaagcgattcgcagccacgctatcgagcaggttggtaagaaactgcgcggttat
atgaccgatatgaagcgtatcgcggtagccggctaa

DBGET integrated database retrieval system