KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_01340Help
Entry
KPNIH30_01340     CDS       T03466                                 

Definition
(GenBank) PTS friuctose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00051  Fructose and mannose metabolism
kpw01100  Metabolic pathways
kpw02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPNIH30_01340
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KPNIH30_01340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpw02000]
    KPNIH30_01340
Enzymes [BR:kpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     KPNIH30_01340
Transporters [BR:kpw02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    KPNIH30_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AIX76926
UniProt: A0A422WJX3
Structure
PDB: 

Position
complement(279961..280455)
Genome map
AA seq 164 aa AA seqDB search
MQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPPGMKVNVV
SLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAV
SLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINETAFCE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaccctcgcccgtattgatgaccgactgattcatggccaggtcaccaccgtg
tggtcaaaagtcgccaacgcccagcggataattatctgcaatgacgatgtatttaacgat
gaggttcgccggaccctgttgcgccaggcggctccgccaggcatgaaggtaaacgttgtc
agtctggaaaaagcggttgcggtctatcataacccgcaatatcaggacgagaccgtcttt
tatttatttaccaatccacacgatgttttaacgatggtgcgccagggcgtgcagatcgcc
acgttaaatattggtggcatggcctggcgacccggtaaaaaacagctaaccaaagccgtt
tctttggatccgcaggatattcaggcattccgtgaactcgataaactgggcgtaaaactc
gatttacgcgtggtcgcatcagatccgtcagtcaatattctcgacaaaattaacgaaaca
gctttctgcgaataa

DBGET integrated database retrieval system