KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_03260Help
Entry
KPNIH30_03260     CDS       T03466                                 

Definition
(GenBank) glutathione transferase
  KO
K21265  glutathione S-transferase fosA5 [EC:2.5.1.18]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:kpw01504]
    KPNIH30_03260
Enzymes [BR:kpw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KPNIH30_03260
Antimicrobial resistance genes [BR:kpw01504]
 Gene variants
  Fosfomycin resistance genes
   Transferases
    KPNIH30_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_6 Glyoxalase_3 DUF1398
Motif
Other DBs
NCBI-ProteinID: AIX77285
UniProt: A0A3N0M9C5
Structure
PDB: 

Position
649345..649764
Genome map
AA seq 139 aa AA seqDB search
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPP
EESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLA
QRLAACREQPYKGMVFFEQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtggactgaatcacctgaccctggcagtcagccagctggcgccgagcgtggcg
ttttatcagcagctgctgggcatgacgctgcatgcccgctgggacagcggggcttatctc
tcctgcggcgatttgtggctgtgcctgtcgctggatccgcagcggcgcgttactccgccg
gaagagagcgactacacccattatgcgtttagtattagcgaagccgattttgctagcttc
gccgcccgccttgaggctgccggcgtggcggtctggaagctgaaccgtagcgaaggtgcc
tcgcactatttcctcgatcccgatggccataagctggagctgcacgtcggcagtctcgcc
cagcggctggccgcctgccgcgagcagccgtataaggggatggtgttttttgaacagtga

DBGET integrated database retrieval system