KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_05650Help
Entry
KPNIH30_05650     CDS       T03466                                 

Definition
(GenBank) ACP phosphodiesterase
  KO
K08682  acyl carrier protein phosphodiesterase [EC:3.1.4.14]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_05650
Enzymes [BR:kpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.14  [acyl-carrier-protein] phosphodiesterase
     KPNIH30_05650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_PD
Motif
Other DBs
NCBI-ProteinID: AIX77726
UniProt: A0A3N0LQ32
Position
complement(1134890..1135471)
Genome map
AA seq 193 aa AA seqDB search
MNFLAHLHLAHLADSSLPGNLMADFVRGNPQGDYPAEIIDGIYMHRRIDVMTDNLAEVKE
AREWFRPQTRRVAPITLDVMWDHFLSQHWTQLSPDLPLDEFVRYAERQIVPILPDSPPRF
VNLNQYLWSERWLERYREMDFIQRVLNGMASRRPRLEALRDSWQDLDTHYDRLETQFWRF
YPQMMRQAENKQL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcgcccacctgcacctggcccatctcgccgacagttcgctgcccggcaac
ctgatggccgacttcgtgcgcggcaacccgcagggcgactatccggcggagatcatcgac
ggcatctatatgcatcgccggattgacgtgatgactgacaacctggcggaagtcaaagag
gcgcgggagtggtttcgcccgcagacccgccgcgtcgcccccatcaccctcgacgtcatg
tgggatcatttcctgtcccagcactggacgcagctctcccctgacctgccgctggacgag
ttcgtacgctacgccgagcggcagatcgtccccatcctgcccgactcgccgccccgcttc
gtcaatctcaatcaatatctgtggtcggagcgctggctggagcgctatcgggaaatggat
tttattcagcgcgtgctgaacggcatggccagccgccgtccacgtctcgaggcgctacgc
gactcctggcaggatctggatacccattacgaccgtctggagacgcagttctggcgcttt
tatccgcagatgatgcgccaggcagaaaacaaacagctgtaa

DBGET integrated database retrieval system