KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_06260Help
Entry
KPNIH30_06260     CDS       T03466                                 

Definition
(GenBank) acyl-CoA thioesterase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.2.2 3.1.1.2 3.1.1.5]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    KPNIH30_06260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpw01004]
    KPNIH30_06260
Enzymes [BR:kpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     KPNIH30_06260
    3.1.1.5  lysophospholipase
     KPNIH30_06260
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     KPNIH30_06260
    3.1.2.-  
     KPNIH30_06260
Lipid biosynthesis proteins [BR:kpw01004]
 Fatty acid synthase
  Component type
   KPNIH30_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK
Motif
Other DBs
NCBI-ProteinID: AIX77846
UniProt: A0A3F3C8I5
Position
complement(1257227..1257850)
Genome map
AA seq 207 aa AA seqDB search
MNFKYVFRWHVPFLLLFLFTCRAMAADTLLILGDSLSAGYRMAANAAWPALLNEQWQAKT
PVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFPPQQTEQTLRTIIKDI
KAANAEPLLMQIHLPANYGRRYNEAFGAIYPALAKEFAIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKRLAPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagtatgttttccgctggcatgtgcctttcctgttgttgttcctgtttacc
tgccgcgcgatggcggcggacacgctgctgatcctcggcgacagcctgagcgctggctat
cggatggcggccaacgccgcctggcctgcgctgctcaatgagcagtggcaggcgaaaacg
ccggtggtgaacgccagcatcagcggcgatacctcgcagcaggggttggctcgcctgcca
gcgctgcttaagcagcaccagccgcgctgggtgctggttgagctcggcggcaatgacgga
ctgcgcggttttccgccgcagcagaccgagcagacgctgcgcaccattattaaagatatc
aaagcggccaacgccgagccgctgctgatgcaaattcacctgccggcgaactatggccgc
cgctataatgaagccttcggcgcgatttacccggccctggccaaagagttcgctattcct
ctcctgcccttttttatggaggaggtctatctcaagccgcaatggatgcaggacgacggc
attcatccaaatcgcgacgcgcagccgtttatcgccgactggatggcgaagcggctggct
cccttagttaatcatgactcctga

DBGET integrated database retrieval system