KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_06835Help
Entry
KPNIH30_06835     CDS       T03466                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00052  Galactose metabolism
kpw00500  Starch and sucrose metabolism
kpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH30_06835
   00500 Starch and sucrose metabolism
    KPNIH30_06835
Enzymes [BR:kpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPNIH30_06835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIX77956
UniProt: A0A2L0G0V4
Position
complement(1353497..1354897)
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGIFDHGPLHELDSGFEFYAPQTMQADDGRRLLVGWMGV
PDGDEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELVALRGEAQGWCGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgtctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcaacggactgctgaac
gatcctaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgcgaccatacctataagtgctggggacactggagctctgccgatctgctgcac
tggcggcacgaacctatcgccctgatgccggatgaagagtatgaccgcaacggctgctac
tctggcagcgcggtcgagttcgagggtgccctgactctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgcaccgcctggcaatgtctggcgaccgagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctgccagaaggctataccggccatgtgcgcgac
cctaaagtgtggcggcaggacgggcgctggtacatggttcttggggcgcaggatgtgcaa
cagcgcggcaaagtgctgctgtttaccgccagcgacctgcgggagtggcgcctggtgggc
gagatcgccgggcacgacgtgaacggcctggcgaacgccggctacatgtgggagtgcccg
gatctctttccgctggcggacacccacctgctgatctgctgcccgcaggggctggcccgc
gaagcgcagcgctttctcaatacctatccggcggtgtggatggcaggccgcttcgacgcc
gaacgcgggatcttcgaccacggcccgctgcacgagctggacagcggatttgagttctac
gcgccgcagaccatgcaggccgacgatggccgccgcctgctggtcggctggatgggcgtc
cccgacggggacgagatgcatcagcccacccgcgcgcagggctggatccatcagatgacc
tgcgtgcgtgagctggagtggcaggctggcactctgtatcagcgtccgctgcgcgagctg
gtcgccctgcgcggggaagcccagggctggtgcggacagaccctgcccctcgccccgatg
gagctggcctttgacatcgcccccaacagcacgctggggctggactttgccggcgccctg
cagctcaccgtcaatcgcgacggtctgcgtctgtcgcgccgcggcctgcagacggcggag
atgcatcaccgctactggcgcggcgaggcgcgccgcctgcggatctttatcgaccgctcc
agcgtagagattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggc
tatccggggcagctcatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagaataa

DBGET integrated database retrieval system