KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_16410Help
Entry
KPNIH30_16410     CDS       T03466                                 

Definition
(GenBank) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00540  Lipopolysaccharide biosynthesis
kpw01100  Metabolic pathways
Module
kpw_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    KPNIH30_16410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kpw01005]
    KPNIH30_16410
Enzymes [BR:kpw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     KPNIH30_16410
Lipopolysaccharide biosynthesis proteins [BR:kpw01005]
 Unusual sugar
  KPNIH30_16410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AIX79756
UniProt: A0A1Y0Q1Y2
Position
complement(3230523..3231377)
Genome map
AA seq 284 aa AA seqDB search
MKQKVVSIGDINVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDK
ANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEASQAQPVADVVDVIQLPAFLAR
QTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDKVILCDRGANFGYDNLVVD
MLGFGVMKKASNNSPVIFDVTHALQCRDPFGAASGGRRAQVSELARAGMAVGIAGLFIEA
HPDPDHAKCDGPSALPLDKLEPFLKQMKAIDDLVKSFDELDTSK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaagtggttagcattggtgatatcaacgtagcgaacgacctgccgttcgtg
ctgttcggcgggatgaacgtgctggagtcgcgcgacctggcgatgcgtatctgcgaacat
tatgtcaccgttacgcagaagcttggtattccctacgtcttcaaagcctcctttgataaa
gccaaccgttcctccatccactcctatcgtgggccgggtctggaagaagggatgaagatt
ttccaggagctgaagcagacctttggcgtgaaaatcatcaccgacgttcatgaagccagc
caggcgcagccggtagctgacgtggtggacgtgatccagcttccggctttcctcgcgcgc
cagactgacctggtggaagcgatggcgaagaccggggcggtgatcaacgtcaagaagccg
cagttcgtcagcccgggtcagatgggcaacatcgtcgataagtttatcgaagggggtaac
gacaaagtaatcctctgcgaccgcggcgctaacttcggttacgacaacctggtcgtggat
atgctcggcttcggcgtgatgaagaaagcctccaacaactcgccggtcattttcgacgtc
acccacgcgctgcagtgccgcgacccgtttggcgcagcctccggcggtcgtcgtgcgcag
gtgagcgagctggcccgcgccggtatggcggtaggtatcgccggtctgtttattgaagcg
catccggatccggaccacgcgaaatgcgacggcccgtccgcgctgccgctggataaactg
gagccgttcctcaaacagatgaaagcgattgacgatctggtgaaaagcttcgacgagctg
gataccagcaagtaa

DBGET integrated database retrieval system