KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_21165Help
Entry
KPNIH30_21165     CDS       T03466                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpw03016]
    KPNIH30_21165
Enzymes [BR:kpw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     KPNIH30_21165
Transfer RNA biogenesis [BR:kpw03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    KPNIH30_21165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIX80640
UniProt: A0A1Y0PVK4
Position
complement(4213281..4214075)
Genome map
AA seq 264 aa AA seqDB search
MLEIIYQDDWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIRKRYHAIVRGWLMEEALLDYPLVEELDRIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTSRYGLVELEPKTGRKHQLRRHLAHLRHPILGDSK
HGDLRQNRSAAEHFGCHRLMLHASELSLTHPFTGEPLTLRAGFDDVWMRALSQFGWRGLL
PLNERVEFADDSGQDEENKVNPGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatctaccaggacgactggctggtggcggtcaacaaaccctcgggctgg
ctggtgcatcgcagctggctcgatcgcgacgagaaagtggtggtgatgcagaccgtgcgc
gaccagatcggtcagcacgtttttaccgctcatcgtctcgaccggcccacctccggcgtg
ctgctgatgggattgtcgagcgaggcgggccggctgctggcgcaacagttcgagcagcac
cagatccggaagcgctaccatgcgatcgtccgcggctggctgatggaagaggcgctgctg
gattacccgctggtagaggagctggatagaatcgccgataagttcgcccgcgaagataaa
gggccgcagccagcggtaacccactaccgcggtctggcgacagtggagatgccagtggcg
actgggcgctatcccacctcgcgctatgggctggtggaactggagccgaaaaccggccgc
aagcaccagctgcgccgtcatctggcccacctccgtcatccgatcctcggcgacagcaag
cacggcgatctgcggcaaaaccgcagcgccgcggaacatttcggctgtcaccgcctgatg
ctgcacgccagcgagctgtcgttaacccatccttttaccggcgagccgctgaccctgcgc
gccggttttgacgacgtctggatgcgcgcgctgtcgcagtttggctggcgcgggcttctc
ccgctaaatgaaagggttgagtttgccgacgacagcggtcaggatgaagagaataaggtc
aatccagggagataa

DBGET integrated database retrieval system