KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_25200Help
Entry
KPNIH30_25200     CDS       T03466                                 

Gene name
arnT
Definition
(GenBank) 4-amino-4-deoxy-L-arabinose transferase
  KO
K07264  4-amino-4-deoxy-L-arabinose transferase [EC:2.4.2.43]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00540  Lipopolysaccharide biosynthesis
kpw01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    KPNIH30_25200 (arnT)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    KPNIH30_25200 (arnT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kpw01003]
    KPNIH30_25200 (arnT)
   01005 Lipopolysaccharide biosynthesis proteins [BR:kpw01005]
    KPNIH30_25200 (arnT)
Enzymes [BR:kpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.43  lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase
     KPNIH30_25200 (arnT)
Glycosyltransferases [BR:kpw01003]
 Polysaccharide
  Bacterial polysaccharide
   KPNIH30_25200 (arnT)
Lipopolysaccharide biosynthesis proteins [BR:kpw01005]
 Lipid A
  KPNIH30_25200 (arnT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_2
Motif
Other DBs
NCBI-ProteinID: AIX81410
UniProt: A0A3N0MJ76
Position
complement(4972410..4974065)
Genome map
AA seq 551 aa AA seqDB search
MKSIRYGVSLIALFALYYLLPLNFRLLWQPDETRYAEISREMLATGDWVVPHFLGLRYFE
KPIAGYWINSIGQWLFGHNNFGVRFGSVFAITMTALLVAWLAWRIFRDKRVAILSPIIFL
TAMLVYAIGTYAVLDPMITLWLALAMCSFWGAAQAHSRSGKILGYVLLGVACGMGVMTKG
FLALAVPVVGVLPWVIARKRWREVLTYGWLAVIVCTLVVLPWGLAIAQREPDFWRYFFWV
EHIQRFAEKDAQHKAPFWYYIPFLIAGSLPWLALLPGALKRGWLERDEARGALYLLGWVA
MPFLFFSIAKGKLPTYILPCFAPLSILMARYALEAAKTGAKALRINGMINLGVGLLGLIA
VLVVSPWGFMHKPVWTKIELYKCLLAAIAFAVWALMGWLAMKDSGRRWSLAALCPLGLAL
LVGFAIPDRVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQG
ELKYGLDWPDAQGSFVSQAGFADWLAAHRQQGPVSLVLLMDKGESMLDLPLPKPDNAYEL
GRVVFLQYLPQ
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattcgctatggcgtctctctgattgcgctgtttgcgctgtattatctgctg
ccgctcaatttccgtttgctctggcaacccgacgaaacccgctacgcggagatcagccgt
gaaatgctggccaccggcgactgggtggtaccgcattttctcggcctgcgctacttcgaa
aaaccgattgccggttactggatcaacagtatcggtcagtggctgtttggccataataac
ttcggcgtacgcttcgggtcggtcttcgccatcaccatgaccgccctgctggtggcctgg
ctggcgtggcggatctttcgtgataagcgggtagctatcctgtcgccgattatcttcctc
accgcgatgctggtgtatgcgattggcacctatgcggtgctggacccgatgatcaccctg
tggctggcgctggcgatgtgcagcttctggggcgcggcgcaggcgcacagccgcagcggc
aaaatactgggctacgtgctgctgggcgtcgcctgcgggatgggggtgatgaccaagggc
ttcctggcgctggcggtgccggtggtgggcgttctgccgtgggtgatcgctcgtaaacgc
tggcgtgaagtgctgacctacggctggctggcggtaatcgtctgtacgctggtggtgctg
ccctgggggctggctatcgctcagcgcgagccggacttctggcgctacttcttctgggtc
gagcatattcagcgttttgctgaaaaagacgcccagcacaaagcgccgttctggtactac
atcccgttcctgatcgccggcagtctgccgtggctggccctgctgccgggggcgctaaag
cgcggctggcttgagcgcgatgaggcccgcggcgcgctgtatctgttaggttgggtggcg
atgccgttcctgttcttcagtatcgccaaaggcaaactgccgacctatattctgccgtgc
tttgcgccgctgtcgatcctgatggcccgctacgcgctggaggccgcaaagaccggcgcg
aaagcgttgcgcatcaacgggatgatcaacctgggcgttggtttgctggggcttatcgcc
gtgctggtggtctcgccgtggggcttcatgcataagccggtgtggaccaagattgagctg
tataaatgtctgctggcggcgatcgcttttgccgtctgggcgctgatgggctggctggcg
atgaaagactctggccgccgctggagcctcgccgcgctctgtccgctcggcctggcgctg
ctggtgggcttcgccatcccggaccgggttatcgacagcaaacagccgcagttcctcgtg
gatatcgtcagcgaatccctgcagcccagccgttacgtcctgaccaacaacgttgggatc
gccggcggcctggcctgggagctgaagcgaagcgatattattatgttcgacaaacagggt
gagctgaagtacggtctcgactggccggatgctcagggaagctttgtcagccaggccggt
tttgccgactggctggccgcgcatcgtcagcaggggccggtctcgctggtgctgttgatg
gataaaggagagagtatgctcgacttaccgttaccgaaaccggataacgcctacgagctg
ggccgggtcgttttccttcagtacctgccgcaatga

DBGET integrated database retrieval system