KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_25210Help
Entry
KPNIH30_25210     CDS       T03466                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00520  Amino sugar and nucleotide sugar metabolism
kpw01100  Metabolic pathways
kpw01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KPNIH30_25210
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    KPNIH30_25210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kpw01005]
    KPNIH30_25210
Enzymes [BR:kpw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     KPNIH30_25210
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     KPNIH30_25210
Lipopolysaccharide biosynthesis proteins [BR:kpw01005]
 Unusual sugar
  KPNIH30_25210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AIX81412
UniProt: A0A430I5X0
Position
complement(4974964..4976949)
Genome map
AA seq 661 aa AA seqDB search
MKAVVFAYHDMGCTGIQSLLDAGYDIAAIFTHPDNPGENHFFGSVARLAAEQGIPVWAPE
DVNHPLWIERIREMKPDVLFSFYYRNLLGDEILNLAPKGAFNLHGSLLPKYRGRAPLNWV
LVNGESETGVTLHRMVNRADAGDIVAQQAVAIGADDAALTLHRKLCAAATELLSRALPAI
LAGTTDERPQDHSQATYVGRRTPEDGRLDWELPAQTLHNLVRAVSDPWPGAFGYAGANKF
IVWKSRVRHDLPAAKPGTVLSIAPLIVACQDGALEIVTGQTERGVYMQGAQLAQALGLVS
GAVISSKPVVAIKRRTRVLILGVNGFIGNHLTERLLQDDNYEIYGLDIGSDAISRFLDCP
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYNKRIIFPSTSEVYGMCTDKNFDEDSSNLVVGPINKQRWIYSVSKQLLDRVIWAYGDK
NGLKFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIEGGKQKRCFTDI
SDGIEALFRIIENKDGRCDGQIINIGNPDNEASIKELAEMLLACFERHPLRDRFPPFAGF
REVESSDYYGKGYQDVEHRKPSIRNAKRCLNWEPKVEMEETVEHTLDFFLRTVELVDDKN
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagtcttcgcttatcacgatatgggctgcaccggtatccagtccctgctg
gacgccgggtatgatatcgctgctattttcacccacccggataaccctggcgaaaaccat
ttctttggctccgtggcgcgccttgccgccgagcagggtattccggtgtgggccccggaa
gacgtgaaccatccgctgtggattgagcgtatccgcgagatgaagccggacgtgctgttc
tccttctactatcgcaacctgctgggcgatgagatcctcaatctggcgccgaaaggggcg
ttcaacctgcacggttcgctgctgccaaaatatcgcggccgcgcgccgctgaactgggtg
ctggtcaatggcgaaagcgaaaccggcgtcaccctgcaccggatggtgaaccgcgcagac
gctggcgatatcgtcgcccagcaggccgtggcgattggcgcggatgacgccgccctgacg
ctgcatcgtaagctgtgcgctgccgccactgagctgctgagccgggcgctgccggcgatc
ctcgccggcaccaccgatgagcgtccgcaggatcacagccaggcaacctatgtggggcgt
cgtaccccggaagatggccggctggactgggagctgccggcgcagaccctgcacaatctg
gtgcgtgcggtctcggatccgtggccgggcgccttcggctacgccggagcgaacaagttt
atcgtctggaaatcccgcgttcgccacgatttgccagcagctaaaccgggcaccgtgctc
tccattgctccgctgatcgtcgcgtgccaggacggggcgctggagattgtcaccggccag
accgaacgcggcgtgtacatgcagggcgctcagctggcgcaggcgctgggcctggtgtcc
ggggcggtgatcagcagcaaaccggtggtggcgattaagcgtcgcacccgggtgctgatc
ctcggcgtcaacggctttatcggtaaccacctgaccgagcgcctgctgcaggacgacaac
tatgagatttacggtctggatatcggctccgacgccatcagccgttttctcgactgtccg
cgtttccactttgtggaaggcgatatcagcattcactctgagtggatcgagtatcacatt
aagaaatgcgacgtggtgctgccgctggtggccatcgccacgcctatcgaatacacccgc
aacccgctgcgcgtgttcgagctggatttcgaagagaacctgaaaatcatccgcgactgc
gtgaaatacaataagcgcattatcttcccgtcgacctcggaagtgtacggcatgtgcacc
gacaaaaactttgacgaagatagctccaacctggtggtggggccgatcaacaaacagcgc
tggatctactcggtctccaagcagctgctcgatcgcgtgatctgggcctatggcgataag
aacggcctgaagttcacccttttccgtccgttcaactggatggggccgcgtctggataac
cttaatgccgcgcgtatcggtagctcccgcgccatcactcagctgatcctcaacctggtg
gaagggtcgccgatcaagcttatcgaaggcggcaagcagaagcgctgcttcaccgacatc
agcgacggtatcgaagcgctgttccgcatcatcgagaacaaagacggccgctgcgacggg
cagatcattaacatcggcaacccggataacgaagcgagtatcaaagagctggccgaaatg
ctgctcgcctgcttcgaacgtcatccgctgcgcgatcgcttcccgccgttcgccggcttc
cgtgaagtggaaagcagcgattactacggaaagggctaccaggacgttgagcatcgtaag
ccgagcatccgcaacgccaaacgctgcctgaactgggagccgaaggtggagatggaagaa
acggtcgaacacacgctggacttcttcctgcgcacggttgaactggtggacgataaaaat
ccatga

DBGET integrated database retrieval system