KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_26470Help
Entry
KPNIH30_26470     CDS       T03466                                 

Definition
(GenBank) D-serine dehydratase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00260  Glycine, serine and threonine metabolism
kpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPNIH30_26470
Enzymes [BR:kpw01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     KPNIH30_26470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AIX81653
UniProt: A0A3N0LUF1
Position
5245384..5246712
Genome map
AA seq 442 aa AA seqDB search
MKNADLTTLTATFPLVQDLIALKETTWFNPATTTLAEGLPYVGLTADDVQDAHARLQRFA
PYLAAAFPETAASCGIIESEVVAIPAMKRSLEQKFGQPISGELLLKKDSHLPISGSIKAR
GGIYEVLTHAEKLALEAGLLTTADDYRKLLTPEFKQFFSQFSIAVGSTGNLGMSIGIMSA
RIGFQVTVHMSADARAWKKAKLRSHGVTVVEYEEDYGVAVEQGRKAAESDPNCFFIDDEN
SRTLFLGYAVAGERLKAQFAKAGRVVDADHPLFVYLPCGVGGGPGGVAFGLKLAFGDHVH
CLFAEPTHSPCMLLGVYTGLHDQIAVQDLGIDNLTAADGLAVGRASGFVGRAMERLLDGF
YTLDDQTMYDMLGWLAAAENIRLEPSALAGMAGAQRVCASKAYHQLQGLSEQQLQQATHL
VWATGGGMVPEEEMAQYLAKGR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgctgacctgaccaccttaaccgcgaccttcccgcttgtgcaggatctgatc
gccctgaaagaaactacctggtttaacccggcaaccaccaccctggcggaggggttgcct
tacgtcggtctgaccgccgacgatgtgcaagacgcccatgcccgccttcagcgcttcgcg
ccctatctggcggcagccttcccggaaaccgccgcgagctgcgggattatcgaatcagaa
gtggttgccattccggcaatgaaacgcagccttgagcaaaaattcggccagccaattagc
ggcgaactgctgctgaaaaaagacagccatctgccaatctccggctcaatcaaagcgcgc
ggtgggatttatgaagtgctgacccatgcggaaaagctggcgctggaagccgggctgctg
acgaccgcagacgattatcgcaaattgctgacgccggagtttaaacagttctttagccag
ttcagcatcgccgtcggctccaccggcaaccttgggatgtcgataggcatcatgagcgcg
cgcattggttttcaagtcacggtgcatatgtccgccgatgccagggcgtggaaaaaagcc
aaactgcgcagccacggcgtaacggtggttgagtatgaagaggactatggcgtggcggtc
gaacaggggcgcaaggcagcggaatccgatccgaactgctttttcattgatgatgaaaac
tcacgcacgctgttcctcggctatgccgtagccggcgagcgcctgaaggcgcagtttgcc
aaagcagggcgcgtggtcgatgccgatcacccgctgttcgtctatctgccgtgcggcgtc
ggcggcggccccggcggcgtggcatttggcctgaagctggccttcggcgaccacgttcac
tgcctgttcgccgaaccgacccattcgccatgcatgctgctcggcgtctataccgggctc
cacgaccagatagcggtgcaggatttaggtattgataacctgaccgcggccgacggtctg
gcggtcggcagggcgtccgggttcgttggccgggcaatggagcgcctgctcgacgggttc
tatacccttgacgaccagacgatgtatgacatgctgggctggctggcggcagcggaaaat
atccgccttgaaccctccgcgctggccgggatggccggagcgcagcgggtctgcgccagc
aaagcgtaccatcagctgcaggggctgagtgagcaacagctgcagcaggccacccacctg
gtgtgggccaccggcggcggcatggtgccggaagaggagatggcgcagtacctggcgaag
gggcgctaa

DBGET integrated database retrieval system