KEGG   Klebsiella pneumoniae PMK1: PMK1_01145Help
Entry
PMK1_01145        CDS       T03419                                 

Definition
(GenBank) Methylmalonyl-CoA carboxyltransferase 5S subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00620  Pyruvate metabolism
kpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMK1_01145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpx02000]
    PMK1_01145
Enzymes [BR:kpx01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PMK1_01145
Transporters [BR:kpx02000]
 Other transporters
  Primary active transporters [TC:3]
   PMK1_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 ADH_zinc_N FliO
Motif
Other DBs
NCBI-ProteinID: AIT00638
UniProt: A0A0C7KM65
Position
complement(1224069..1225853)
Genome map
AA seq 594 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQAALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTQYDTGLDIHRLESIAAYFREVRKKYHAFEGQLKGTDSRILVAQVPGGML
TNLESQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLDGADPVTCRPADLLKPELAQLEADVRRQAQEK
GITLAENAIDDVLTVALFPQPGLKFLENRHNPAAFEPVPQAEAAQPVAKAEKPAASGVYT
VEVEGKAFVVKVSDGGDVSQLTAAAPAPAPAPASAPAAAAPAGAGTPVSAPLAGTIWKVL
AAEGQTVAAGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLMTLA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtccctgttcgctacc
cgtctgcgtctcgacgatatgctgcccgttgccgctcagctggacgacgtcggctaccgc
tcccttgagtgctggggcggcgccacctttgatgcctgcatccgctttctcggcgaggac
ccgtgggtccgcctgcgcgagctgaaaaaggcgatgcccaagaccccgctgcagatgctg
ctccgcggccagaacctgctcggctaccgccactacgccgacgacgtggtggagcgcttc
gtggagcgcgccgtcaaaaacggcatggacgtcttccgcgtcttcgatgccatgaacgac
ccgcgcaacatgcaggccgccctgcaggcggtccgccgccacggcgcccacgcccagggt
acgctttcgtacaccaccagcccggcccacaccctgcagacctggctcgacctcaccgaa
cagctgctggagaccggcgttgactccgtcgccatcaaggacatgtccggcattctgacg
ccgcatgccgcctttgagctggtcagcgaaatcaagaagcgctacgacgtcaccctgcac
ctgcactgccatgccaccaccgggatggcggagatggccctgctgaaggccattgaagcc
ggggtcgacggcgtcgataccgccatctcctcgatgagcgccacctatggccacccggcc
accgaggcgctggtggccaccctcgccggcacgcaatatgacaccgggctggatatccac
aggctggagagcatcgccgcctactttcgcgaggtgcgcaaaaaataccacgccttcgaa
ggccagctgaagggcaccgacagccgtatcctcgtcgcccaggtgccgggcgggatgctc
accaacctcgaaagccagctgaagcagcagagcgccgcccaccgtctggatgaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggcttcatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggcgagcgctacaaaaccatt
gcgaaggagaccgccggtattctgaaaggcgaatacggccgcaccccggcgccggtgaac
gccgccctgcaggcgcgggtgctcgacggcgccgacccggtgacctgccgcccggccgac
ctgctgaagccggagctggcgcagctggaagccgacgtcagacgccaggcgcaggagaag
ggcatcacgcttgccgaaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcag
ccaggcctgaagttcctcgaaaaccgccacaacccggcagcctttgagccggtaccgcag
gcggaagccgcgcagccagtggcaaaagcagaaaaacctgccgcctccggcgtctacacc
gtggaggtggaaggcaaagcctttgtggtcaaagtcagcgacggcggtgacgtcagccag
ctgacggcggctgctcctgctcctgctcctgctcctgcctctgcacccgccgctgccgcc
ccggccggcgccggtaccccggtgtccgccccgctggcgggcaccatctggaaggtgctg
gccgcggaaggccagacggtggccgcaggcgaggtgctgctgattctggaagccatgaag
atggaaaccgaaatccgcgccgcgcaggccgggaccgtgcgcggtatcgcggtgaaagcc
ggcgacgcggtggcggtcggcgacaccctgatgaccctggcgtaa

DBGET integrated database retrieval system