KEGG   Klebsiella pneumoniae PMK1: PMK1_02355Help
Entry
PMK1_02355        CDS       T03419                                 

Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
kpx  Klebsiella pneumoniae PMK1
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PMK1_02355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Pax2_C
Motif
Other DBs
NCBI-ProteinID: AIT01820
UniProt: C4T9E5
Position
complement(2537053..2537430)
Genome map
AA seq 125 aa AA seqDB search
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattcattcgccccgggtgtgtgtccaggtacagagcgtctatatcgaatcgcagtct
tccccggaagaagagcgctacgtcttcgcttacaccgtcaccattcgcaacctggggcgg
agtcaggttcagctgcttggccgctactggctcatcactaacggccacggtcgtgagact
gaagttcagggtgaaggggtggtcggcgagcaaccgcatattcccgccggcggtgaatat
caatataccagcggcgcagtgattgaaacgccgctgggaaccatgcagggtcattatgaa
atgatcgatatcgacggcgcgccgttccgtattgagatccctgttttccgtctcgcagtt
ccaacgctcattcattaa

DBGET integrated database retrieval system