KEGG   Klebsiella pneumoniae PMK1: PMK1_02732Help
Entry
PMK1_02732        CDS       T03419                                 

Gene name
ppiD
Definition
(GenBank) Peptidyl-prolyl cis-trans isomerase D
  KO
K03770  peptidyl-prolyl cis-trans isomerase D [EC:5.2.1.8]
Organism
kpx  Klebsiella pneumoniae PMK1
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:kpx03110]
    PMK1_02732 (ppiD)
Enzymes [BR:kpx01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PMK1_02732 (ppiD)
Chaperones and folding catalysts [BR:kpx03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    PMK1_02732 (ppiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurA_N_3 SurA_N_2 Rotamase_2 Rotamase_3 Rotamase SurA_N CFTR_R
Motif
Other DBs
NCBI-ProteinID: AIT02192
UniProt: A0A0C7KI34
Position
2960730..2962604
Genome map
AA seq 624 aa AA seqDB search
MMDNLRTAANSVVLKIIFGIIIVSFILTGVSGYLIGGGKNYAAKVNGQEIGRGQFENAVA
SERNRMQQQLGDQFSELAANENYMKTMRQQVLNRLIDESLLDQYARELGLSISDEQVKQA
IFQTQAFQTNGKFDNQRFSGIVAQMGMTTDQYAQALRNQLTTQQLINAIAGTDFMLPGES
DQLAALVSQQRVVREATINVNALAAKQTASDEEINAFWQQNQARFMAPEQFRVSYIKMDA
ASMQESASDEEIQSWYDQHKDQFTQPQRNRYSVIQTKTEADAKAVLAELQKGADFAALAK
EKSTDIISARNGGDMGWMEDASTVPELKDAGLKEKGQLSGVIKSSVGFLVARLDDVQPAQ
VKPLADVRNDIAAKVKQEKALDAYYALQQKVSDAASNDNESLASAAQVAGLKVVETGWFG
RDNLPEELNFKPVADAIFNGGLVGENGAPGSNSDIITVDGDRAFVLRISEHKAEAVKPLA
EVKAQVSDIVKHNKAEQQAKLEADKLLAALKDGKGDEAMKAAGLSFGAPQTLSRTGQDPL
SQLAFTLPLPQQGKPVYGVGSNMQGDVVLVALDEVKAGSMPEEQKKAMVQGITQNNAQIA
FEALMSNLRKAAKIKLGDSIDQQQ
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgatggacaacctacgcacggccgccaacagcgtcgtgctcaagattattttcggtatc
attatcgtctcgttcattttgaccggggtgagtggttacctgattggcggtggcaaaaac
tatgccgcaaaagtgaatggccaggagattggccgtgggcagtttgaaaacgccgtcgcc
agcgaacgtaaccgtatgcagcagcagcttggcgatcaattctccgagctggcggcgaac
gaaaactacatgaaaaccatgcgccagcaggtgctgaaccgcctgatcgatgagtcgctt
ctggatcagtatgcccgcgagctgggcctcagcatcagcgatgagcaggtgaagcaggcg
atcttccagacccaggcgttccagacgaacggtaagttcgacaaccagcgtttcagcggt
attgtcgcccagatggggatgaccaccgatcagtacgcccaggcgctgcgtaaccagctg
accacgcagcagctgattaacgccattgcgggtaccgacttcatgctgccgggcgagtcc
gatcagctggcggcgctggtatctcaacagcgggtggtccgcgaagcgaccatcaacgta
aatgccctggcggcaaaacagaccgccagcgatgaggaaatcaacgccttctggcagcag
aatcaggcccgttttatggcgccggagcagttccgcgtcagctacatcaaaatggatgcc
gccagcatgcaggagagcgcctctgacgaagagattcagtcatggtacgaccagcacaag
gatcagttcactcagccgcagcgcaaccgctacagcgtgattcagaccaaaactgaagcc
gatgcgaaagcggtactggccgagctgcaaaaaggagcggacttcgccgcgctggcgaaa
gaaaaatcgaccgatattatctctgcccgcaacggcggcgatatggggtggatggaagat
gcctctaccgtgcctgagctcaaagatgccgggctgaaagagaaaggccagctgtctggc
gtgatcaaatcctcggttggcttcctggtagctcgtctggacgacgtccagccggcgcag
gtgaagccgctggctgacgtgcgtaatgacattgcggcgaaagtgaagcaggaaaaagcg
ttggatgcttactacgcgctgcagcagaaggtgagcgatgcggccagcaacgataatgaa
tcgctggcgagcgcagcgcaggtcgccgggctgaaggtcgtagaaaccggctggtttggc
cgcgataacctgccggaggagctgaactttaaaccggtcgctgacgctattttcaacggc
ggtctggtgggtgagaacggcgcgccgggcagcaactccgatatcattaccgttgacggc
gatcgcgcttttgttctgcgcattagcgaacacaaagccgaggcggtgaagccgcttgcc
gaagtgaaggcacaggttagcgatatcgttaagcacaataaagcggaacagcaggcgaaa
ctggaggccgacaagctgctggcggcgctgaaagacggcaaaggcgatgaagcgatgaag
gcggctggcctgagctttggcgcgccgcagacgctttctcgtaccggccaggatccgctg
agccagctggcatttaccctgccgctgccgcagcagggtaaaccggtctacggcgtgggc
agcaatatgcaaggcgatgtggtgctggtagcgctggatgaggtgaaagccggcagcatg
ccggaagagcagaagaaggccatggttcaggggatcacccagaacaatgcccaaatcgct
ttcgaagcgctgatgagcaacctgcgcaaggcggcgaaaattaagctcggcgacagcatc
gaccagcagcagtaa

DBGET integrated database retrieval system