KEGG   Klebsiella pneumoniae PMK1: PMK1_03873Help
Entry
PMK1_03873        CDS       T03419                                 

Gene name
mqo_2
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00020  Citrate cycle (TCA cycle)
kpx00620  Pyruvate metabolism
kpx01100  Metabolic pathways
kpx01110  Biosynthesis of secondary metabolites
kpx01120  Microbial metabolism in diverse environments
kpx01200  Carbon metabolism
Module
kpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMK1_03873 (mqo_2)
   00620 Pyruvate metabolism
    PMK1_03873 (mqo_2)
Enzymes [BR:kpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PMK1_03873 (mqo_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AIT03315
Position
4193541..4195187
Genome map
AA seq 548 aa AA seqDB search
MKKTIISLTALAMLVSAATHAEADTSKKTDFLLIGGGIMSASLGTWLQALQPDWDLTMVE
KLDGVALESSNGWNNAGTGHSANMELNYTPERADGSIDVSKALDINEQFMISRQFWSAQV
KRGILHDPHSFINSTPHMSFVWGDNVDYLQKRYNALQQTTLFQGMKFSTDHAQIKQWAPL
VMEGRDPQQKVAATWTPVGTDVNYGEITRQLIGSLKKNNHFTLQTSSEVTDFKRNADNSW
HVTIKNVQSGEAQTIDAKYVFIGAGGGALKLLQKTGIPEADNYAGFPVGGSFLMTENPAV
TAQHLEKVYGQASVGAPPMSVPHLDARYLDGKRVVLFGPFATFSTKFLKNGSFFDLLSTT
TTNNVLPMTHVGLDNFDLVKYLVSQVMLSDDDRFAALKEYYPDARKEDWKLIQAGQRVQI
IKKDAEKGGVLKLGTEVVVDQQKTISALLGASPGASTAAPITLNVLKQMFPQQFNSPEWQ
SRIHAIVPSYGQKLNGNVALTQQVWDDTAATLQLTKPPVIQMPAAAPTATAKPAETPREA
SPQHDMAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattatttccttaaccgcattagcgatgttggtcagcgcggcgacgcat
gctgaagcggatacctcgaaaaaaaccgacttcctgctgattggcggcgggatcatgagc
gcctcgctcggcacctggctgcaggcgctgcagccggactgggatctgaccatggtggag
aaactagacggcgtggcgctggagtcttccaacggctggaataatgccggtactggccac
tcggcgaatatggagctgaactatacgccggagcgggcggacgggtcgattgacgtcagc
aaagcgctcgatattaacgagcaatttatgatttcccgtcagttctggtcggcacaggtg
aaacgcggtattttgcacgatccgcactcgtttattaattccacgccgcatatgagcttc
gtctggggtgataatgtggattatctgcagaagcgttataacgcgctgcagcagaccacc
ttattccaggggatgaaattctccaccgatcacgcgcaaattaaacagtgggcgccgctg
gtgatggaaggccgcgatccgcagcagaaagtggcagccacctggacgccggtgggtacc
gatgtcaactacggcgaaatcactcgccagctgatcggcagcctgaagaaaaataaccac
ttcaccctgcagacctcctctgaggtaacggatttcaaacgtaatgccgacaactcctgg
cacgtaacgattaagaatgtgcagagcggggaagcgcagactattgacgccaaatacgtc
tttatcggcgccggcggcggcgcgttgaagctgctgcaaaaaaccggtattccggaagcg
gacaactatgccggcttcccggtgggcggctcgttcctgatgaccgagaacccggcggtc
actgcgcagcacctggagaaagtgtatggccaggcttcagtcggcgcgccgccgatgtcg
gtgccgcaccttgatgcacgttacctcgacggtaagcgcgtggtgctgtttgggccattc
gccaccttctcgaccaagttcctgaaaaatggttcgttcttcgatctgctcagcactacc
accaccaataacgtgctgccgatgacccacgtcggtctcgacaacttcgatctggtgaaa
tacctggttagccaggtgatgctcagcgatgatgaccgtttcgctgcgctgaaagagtac
tacccggacgcgcgtaaagaagactggaaactgatccaggccggccagcgcgtccagatc
atcaagaaagacgcagagaagggcggcgtgctgaagctcggtaccgaagtggtggtcgat
cagcagaaaaccatttccgcgctgctcggcgcttcgccgggggcttccaccgccgcgccg
atcaccctgaacgtgctcaagcagatgttcccgcagcagtttaactcgccggagtggcag
agccgcattcacgctattgtgccgagctacggccagaagctgaacggtaacgtggcgctg
acccagcaggtttgggatgacaccgctgcgaccctgcagctgacgaaaccgccggtgatc
cagatgccagcggctgcgcctaccgcgaccgccaagccggcagagacgccgcgcgaggcc
tcgccgcagcacgatatggcgctgtaa

DBGET integrated database retrieval system