KEGG   Klebsiella pneumoniae PMK1: PMK1_04026Help
Entry
PMK1_04026        CDS       T03419                                 

Gene name
thlA_2
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00071  Fatty acid degradation
kpx00072  Synthesis and degradation of ketone bodies
kpx00280  Valine, leucine and isoleucine degradation
kpx00310  Lysine degradation
kpx00362  Benzoate degradation
kpx00380  Tryptophan metabolism
kpx00620  Pyruvate metabolism
kpx00630  Glyoxylate and dicarboxylate metabolism
kpx00640  Propanoate metabolism
kpx00650  Butanoate metabolism
kpx00900  Terpenoid backbone biosynthesis
kpx01100  Metabolic pathways
kpx01110  Biosynthesis of secondary metabolites
kpx01120  Microbial metabolism in diverse environments
kpx01130  Biosynthesis of antibiotics
kpx01200  Carbon metabolism
kpx01212  Fatty acid metabolism
kpx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMK1_04026 (thlA_2)
   00630 Glyoxylate and dicarboxylate metabolism
    PMK1_04026 (thlA_2)
   00640 Propanoate metabolism
    PMK1_04026 (thlA_2)
   00650 Butanoate metabolism
    PMK1_04026 (thlA_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PMK1_04026 (thlA_2)
   00072 Synthesis and degradation of ketone bodies
    PMK1_04026 (thlA_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PMK1_04026 (thlA_2)
   00310 Lysine degradation
    PMK1_04026 (thlA_2)
   00380 Tryptophan metabolism
    PMK1_04026 (thlA_2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PMK1_04026 (thlA_2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PMK1_04026 (thlA_2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PMK1_04026 (thlA_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpx04147]
    PMK1_04026 (thlA_2)
Enzymes [BR:kpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PMK1_04026 (thlA_2)
Exosome [BR:kpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMK1_04026 (thlA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIT03468
UniProt: W9BGD9
Position
complement(4342107..4343297)
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRDTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgtcggcaacgttggg
caaatcgccgaaagcggttttatcgcccgcatctgtcagctgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgcggctccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccatggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggagggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcgacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggggcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaacgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtctcgacccggcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtaggcgccagcggtgcgattctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system