KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_02230Help
Entry
KPNIH31_02230     CDS       T03467                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00564  Glycerophospholipid metabolism
kpy01100  Metabolic pathways
kpy01110  Biosynthesis of secondary metabolites
Module
kpy_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPNIH31_02230 (psd)
Enzymes [BR:kpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     KPNIH31_02230 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AIX82506
UniProt: A0A2X3G422
Position
complement(452205..453167)
Genome map
AA seq 320 aa AA seqDB search
MLNDLKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMKEAQKPDTAAY
RTFNDFFVRPLRDDVRPLNTDPNVLVMPADGVISQLGAIENDKILQAKGHDYSLEALLAG
NYQMADLFRNGSFATTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWSGTVTPPREGIIKRWTWPAGDNEGSIA
LLKGQEMGRFKLGSTVINLFAPGQVKLVDTLQSLSVTKIGQPLATAVEATAAAEPAPLPE
EEIRAEHRASPLVDDKQDQG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaacgatcttaaactttcactgcaatacattctgcctaaactgtggctcacccgc
ctcgcaggctggggtgcgagcaaacgcgcaggttggctgacgaagctggtcatcgatctg
ttcgtgaaatactacaaggtcgatatgaaagaggcgcagaagccggataccgcggcttat
cgcaccttcaacgatttcttcgtgcgcccgctgcgcgacgacgttcgcccgctgaatacc
gatccaaacgtgctggtgatgccggccgatggcgtgatcagccagcttggcgccattgag
aacgataaaatcctgcaggctaaaggtcatgactacagtctggaagccctgctggccggc
aactatcagatggccgacctgttccgtaacggcagcttcgccaccacctacctgtcgccg
cgcgactatcaccgcgtacatatgccgtgcaacggcatcctgcgcgaaatgatctacgtt
cctggcgacctgttctctgttaaccacttgacggcgcagaacgtcccgaacctgttcgcc
cgtaacgagcgcgtcatctgcctgtttgatactgagtttggcccgatggcgcaaattctg
gtgggcgcaactatcgtcggcagcattgagaccgtgtggtccggcaccgtgaccccgccg
cgcgaaggcattattaaacgctggacctggcccgctggcgacaacgaaggctccatcgcc
ttgctgaaaggccaggagatgggccgcttcaaactgggttccaccgtgatcaacctgttt
gccccgggccaggtgaagctggtcgacacgctgcaaagcctgtccgtgaccaagatcggc
caaccgctggcgacagcagtggaagcgaccgccgccgctgaacccgcgccgttaccggaa
gaagagatccgcgccgaacaccgcgccagcccgctggttgacgataaacaagaccaaggt
taa

DBGET integrated database retrieval system