KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_03975Help
Entry
KPNIH31_03975     CDS       T03467                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    KPNIH31_03975 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Pax2_C
Motif
Other DBs
NCBI-ProteinID: AIX82820
UniProt: A0A1Y0Q539
Position
816347..816724
Genome map
AA seq 125 aa AA seqDB search
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattcattcgccccgggtgtgtgtccaggtacagagcgtctatatcgaatcgcagtct
tccccggaagaagagcgctacgtcttcgcttacaccgtcaccattcgcaacctggggcgg
agtcaggttcaactgcttggccgctactggctcatcactaacggccacggtcgtgagact
gaagttcagggtgaaggggtggtcggcgagcaaccgcatattcccgccggcggtgaatat
caatataccagcggcgcagtgattgaaacgccgctgggaaccatgcagggtcattatgag
atgatcgatatcgacggcgcgccgttccgtattgagatccctgttttccgtctcgcagtt
ccaacgctcattcattaa

DBGET integrated database retrieval system