KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_09905Help
Entry
KPNIH31_09905     CDS       T03467                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPNIH31_09905 (pdxA)
Enzymes [BR:kpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     KPNIH31_09905 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     KPNIH31_09905 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Rapsyn_N
Motif
Other DBs
NCBI-ProteinID: AIX86979
UniProt: A0A3F3BWG1
Position
2043421..2044428
Genome map
AA seq 335 aa AA seqDB search
MSAEKKPVVAITIGDPAGIGPEITVATMMDKSVYDECKPFLIGSVPIISRAMKIMGCDFA
IHKIAHPQEARFSWGTLDVLETGDYDCDSIEWGKVQKLAGQMSLDYVMKSIELGKAGLID
VVSTAPIHKEAIKLAGCKLPGHTEIYQVETQSDYGLTMFHVHNLRVFFVSRHMALKAACD
YANKARVLACVQQIHHEFTALNIKNPRIAVAALNPHGSDNGLFGHEEADNLIPAVKAAQE
MGINAIGPVPADSVFHLGKQGRYDAILSLYHDQGHIACKTLDFERSITITFGLPFMRSSV
DHGTAFDIAGTGKAGTVSMLESTLVAARYWKMKHQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagagaaaaaacccgttgtggcgattaccattggcgatccggcagggatcggc
ccggagatcaccgtggccaccatgatggacaaaagcgtgtatgacgagtgcaaaccgttc
ctgatcggctcggtaccgattatcagccgggcgatgaaaatcatgggctgcgattttgct
atccataaaattgcccatccgcaggaggctcgtttcagctgggggacgttggatgttctg
gaaactggcgactacgattgcgacagtatcgaatggggcaaggtgcagaaactggcgggg
caaatgtcgctggactatgtgatgaagtcgatcgagctgggtaaagcggggctgatcgac
gtggtctctactgcaccaattcataaggaagccatcaagctggcaggatgtaagctcccg
ggccataccgaaatctatcaggtggaaacccaatctgattacggtctgaccatgttccac
gtccacaacctgcgcgtcttcttcgtgagccgtcatatggcgctaaaagcagcctgtgac
tatgccaacaaagcgcgagtgctggcctgcgttcagcagatccaccatgaatttaccgcc
ctgaacatcaaaaatccgcgcattgccgtggccgccctgaacccgcatggttccgacaat
ggtctgtttggtcacgaagaggctgacaatctgatcccggcggtgaaagcggcccaggag
atggggatcaacgctatcgggccggttccggccgattccgtgttccatctcggcaaacag
gggcgctacgacgccattctctcgctgtatcacgatcaggggcatattgcctgcaaaacc
ctcgactttgaacgttcgatcaccattaccttcggcctgccgtttatgcgcagctccgtc
gaccatgggacggcgtttgatatcgccggtaccggtaaggcgggtaccgtcagtatgctg
gagtcgacgctggtggcggcccgttactggaaaatgaagcatcaataa

DBGET integrated database retrieval system