KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_14920Help
Entry
KPNIH31_14920     CDS       T03467                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00480  Glutathione metabolism
kpy00590  Arachidonic acid metabolism
kpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    KPNIH31_14920 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPNIH31_14920 (btuE)
Enzymes [BR:kpy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KPNIH31_14920 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AIX84851
UniProt: A0A422Y1M7
Position
complement(3027155..3027706)
Genome map
AA seq 183 aa AA seqDB search
MQHDILNTEVTTIDGEKTTLASFAGKVLLIVNVASKCGLTPQYEQLEDLQKQFAAEGFSV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPLFSKIDVNGEHRAPLYQKLIAAAPKAVA
PEGSGFYERMASKGRAPLYVDDILWNFEKFLVDRQGNVIQRFSPDMTPDDPQLVAAIKGA
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatgacattctgaataccgaagtgacgaccattgatggcgagaaaaccaccctg
gcatcctttgccggcaaggtgctgctgatcgtcaatgtggcctcgaaatgcggcctgacg
ccgcagtatgagcaactcgaggatctgcaaaagcagtttgccgccgagggcttcagcgtg
ctggggttcccctgcaaccagttcctcggccaggagccgggcagtgaagaggagattaag
accttctgcagcaccacctacggcgtcaccttcccgctgtttagcaaaattgacgtcaac
ggcgaacatcgcgcgccgctctatcaaaaactgattgccgccgcaccgaaagcggtggcc
ccggaaggcagcggtttttatgagcggatggccagcaaaggccgggcgccgctgtatgtg
gacgacattctgtggaacttcgaaaaattcctcgtcgatcgccagggcaacgtcatccag
cgcttctctccggatatgacgccggacgatccgcagctggtggcggcgattaaaggagcg
ctggcgcaataa

DBGET integrated database retrieval system