KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_15795Help
Entry
KPNIH31_15795     CDS       T03467                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00010  Glycolysis / Gluconeogenesis
kpy00020  Citrate cycle (TCA cycle)
kpy00620  Pyruvate metabolism
kpy01100  Metabolic pathways
kpy01110  Biosynthesis of secondary metabolites
kpy01120  Microbial metabolism in diverse environments
kpy01130  Biosynthesis of antibiotics
kpy01200  Carbon metabolism
Module
kpy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH31_15795
   00020 Citrate cycle (TCA cycle)
    KPNIH31_15795
   00620 Pyruvate metabolism
    KPNIH31_15795
Enzymes [BR:kpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     KPNIH31_15795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: AIX85011
Position
complement(3181748..3183364)
Genome map
AA seq 538 aa AA seqDB search
MALQELGINASGEFFYNPDYDLLIAHETSPELTGAARGVMTDSGAVAVDTGIFTGRSPRD
KYIVRDEQTRDTVWWADSGLGRNDNKPLSPDVWRSLKSLVAGQLSGKKLYVIDAWCGASP
DTRLGVRFVTEVAWQAHFVKNMFIVPSADELASFTPDFVVLNGAGCTNANWQAQGMNSEN
FVAFNLSERIQLIGGTWYGGEMKKGLFSVMNYLLPQKGIASMHCSANRGEAGDVALFFGL
SGTGKTTLSTDPHRQLIGDDEHGWDDDGVFNFEGGCYAKTINLDPQAEPEIYGAIRRNAL
LENVVVRADGSVDYADGSKTENTRVSYPLSHIDNIVKPVSRAGHPSKVIFLAADAFGVLP
PVSRLTTEQMQYHFLSGFTSKLAGTERGITQPTPTFSACYGAAFLLLHPTQYASVLAAKM
AESGAEAWLVNTGWNGEGKRLSLRDTRSIISAILNGTTGPLREETIPVFGLAIPQSIPGV
DSAVLDPRNGWSSADKWQEKAESLAQLFMDNFKQYSDTEAGARLALAGPQLQKSAVEA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcaggagctggggattaatgcaagcggcgaattcttttacaaccctgattac
gatttgcttattgcacatgaaacctctcctgagctgaccggcgcggcccgcggcgtgatg
accgactctggcgctgtggctgttgataccgggatcttcaccggccgttcgccgcgcgat
aaatacatcgtccgcgacgaacagactcgcgacaccgtctggtgggcagactccggcctc
ggccgtaatgacaataagccgttatcgccagacgtgtggcgcagcctgaaaagcctggtc
gcgggccagctgagcggcaaaaaactgtacgtcatcgacgcctggtgcggcgccagcccg
gacacccgtcttggcgtacgcttcgtcaccgaggtggcgtggcaggcccactttgtcaaa
aacatgtttatcgtgccaagcgccgacgagctggccagctttacgccagacttcgtggtg
ctcaacggcgcgggctgcaccaatgccaactggcaggcgcaggggatgaactccgagaac
tttgtcgcctttaatctcagcgagcgtattcagctcatcggcggtacctggtacggcggc
gaaatgaagaaagggctgttctcggtcatgaactacctgctgccgcagaaaggcatcgcg
tcgatgcactgctcggccaaccgtggcgaagcaggggacgtggcgctgttcttcggcctc
tccgggaccgggaaaaccaccctgtcgaccgatccgcatcgtcagctgattggcgatgac
gagcacggttgggacgatgacggcgtgtttaacttcgaaggcggctgctacgctaagacc
atcaatctcgatccgcaggcggagccggagatttatggcgccatccgccgcaatgcgctg
ctggaaaacgtggtggtgcgcgctgacggcagcgtggattatgccgacggcagcaaaacc
gaaaacacccgcgtctcctatccgctgtcgcatatcgacaatatcgtcaagccggtgtcc
cgcgcgggccatccgtcgaaggtgattttccttgccgccgatgcgtttggcgttctgccg
ccggtctcccgtctgaccaccgagcagatgcagtaccatttcctgtcgggtttcacctcg
aagctggcgggcaccgagcgcggcattacccagccgacgccgaccttctccgcctgctat
ggcgcggcgttcctgctgcttcacccgacccagtacgccagcgtcctggcggcgaagatg
gcggaatccggcgccgaagcctggctggtcaacaccggctggaacggcgagggtaaacgc
ctgtcgctgcgcgatacccgcagcatcattagcgcgatcctcaacggcactaccggcccg
ctgcgcgaggagaccatcccggtgttcggtcttgcgatcccgcagagcattccaggggta
gacagcgcggtgctggatccgcgtaatggctggagttcagcggataaatggcaggagaag
gccgagagcctggctcagctgtttatggataacttcaagcagtacagcgataccgaagcg
ggcgcgcgtctggcgctggccggtccgcagctgcagaagagcgcggtcgaagcctga

DBGET integrated database retrieval system