KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_20630Help
Entry
KPNIH31_20630     CDS       T03467                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00860  Porphyrin and chlorophyll metabolism
kpy01100  Metabolic pathways
Module
kpy_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPNIH31_20630
Enzymes [BR:kpy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     KPNIH31_20630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase Peptidase_C26 SNO
Motif
Other DBs
NCBI-ProteinID: AIX85894
UniProt: A0A422YP01
Position
complement(4187335..4188858)
Genome map
AA seq 507 aa AA seqDB search
MTLAVMLQGTASDVGKSVLVAGLCRIFHQDGLRTAPFKSQNMALNSGITPDGKEMGRAQI
FQAEAAGIAPDVRMNPILLKPTSDRQAQVVLMGQVATSMDAMSYHQYKPRLREQILAVYQ
SLAGEYEALVLEGAGSPAEINLRDRDIVNMGMAEMAQCPVILVADIDRGGVFAAIYGTLA
LLQPQERARVKGVIINKFRGDVALLRSGIEQIEALTGVPVLGVMPWLDVDLEDEDGVALQ
AGKYHRTDRRDIDIAVVHLPHIANFTDFNALAAQPDVRVRYVRDPQALADADLVILPGSK
NTLGDLCWLRESGMAHAVEQARQRKVPLLGICGGYQMLGETIIDEVESGLGAQPGLGVLK
TVTHFAQHKTTTQVQATLGSALPDWLADAAGLRVSGYEIHMGETRREAGCPPLLQLHKAG
QAVDDGAISDDGLAFGTYLHGLFDSDAFTRALLNGLRQRKGLAPLDSALEYARYKTRQFD
RLAEAMREHIAIDKIYAIMRQHQEPLC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggcagtgatgttgcagggcacggcttccgacgtggggaaaagcgtgctggtg
gcgggactgtgccgcatttttcatcaggatgggctgcgtaccgcgccgtttaaatcacag
aatatggcgctgaactccggcattacgccggatggcaaagagatgggccgggcgcagatt
ttccaggccgaagcggccgggattgcgccagatgtccgcatgaatccgattttgctcaag
cccaccagcgaccgtcaggcgcaggtggtgctgatggggcaggtggcgaccagcatggat
gcgatgagctatcatcagtacaagccgcgcctgcgcgagcagatcctcgcggtctaccag
agcctggccggagagtatgaggcgctggtgctggaaggcgccggcagtccggcggagatt
aacctgcgcgaccgcgatatcgtcaatatgggcatggccgagatggcgcaatgcccggtg
atcctggtggccgatatcgaccgcggcggggtgtttgccgcgatttacggcacgctggcg
ctgctgcagcctcaggagcgggcgcgggtgaaaggggtgatcatcaataaattccgcggc
gatgtggcgctcctgcgctccgggatagagcaaatcgaggcgttgaccggggtgccggtg
ctgggcgttatgccatggcttgacgtggatctcgaggatgaggacggcgtcgcgctgcag
gccgggaaataccatcgcaccgaccggcgcgatatcgacatcgccgtggttcacctgccg
catatcgccaattttaccgactttaacgccctggcggcacagccagacgtccgggtgcgc
tatgtccgcgatccgcaggcgctggccgacgccgacctggtcattctcccgggcagtaaa
aataccctcggcgatctgtgctggctgcgcgagagcggcatggcgcacgcggtcgagcag
gcccggcagcgcaaggtgccgctgctggggatctgcggcggctatcagatgctgggcgaa
accattatcgatgaggtggagtctggccttggcgcccagcccgggctgggggtgctgaag
accgtgacccacttcgcccagcacaaaaccaccacccaggtgcaggcgaccctggggtct
gcgctcccggattggttagccgacgcggcggggctgcgcgttagtggctacgaaattcat
atgggcgagacgcgccgcgaggcaggctgcccgccgctgctgcagctgcataaagcgggg
caggcagtagacgacggggcgataagcgacgacggcctggcgttcggcacctatctccat
ggcctgttcgacagcgatgcctttacccgggcgctgctcaacggcctgcgccagcgcaaa
gggctggcgccgctggacagcgccctggagtatgcccgctataaaacccggcagtttgat
cggctggccgaggccatgcgcgaacatatcgccatcgataaaatttacgccatcatgcgc
caacatcaggagcccctatgctga

DBGET integrated database retrieval system