KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_08985Help
Entry
KPNIH27_08985     CDS       T03370                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00010  Glycolysis / Gluconeogenesis
kpz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH27_08985
Enzymes [BR:kpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     KPNIH27_08985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AIA41450
Position
1901467..1902732
Genome map
AA seq 421 aa AA seqDB search
MTKDEGMKKRLLAAAVAGAVMLSAGAQAQDTAAPEGYQLQQVLIMSRHNLRAPLANNGSV
LEQSTAKAWPQWDVPGGQLTTKGGVLEVYMGHYMREWLAQQKLVTSGECPPENAVYAYAN
SLQRTVATAQFFITGAFPGCGIPVHHQPQMGTMDPTFNPVITDDSPAFREKALQAMEKER
QGMQLTESYKLLETMIDYRNSPSCKEKKVCSLSEGKDTFSAGYQQEPGVSGPLKVGNSLV
DAFTLQYYEGFPKDQVAWGEIASDKQWQVLSKLKNGYQDSLFTSVAVAQNVAKPLVKYID
NALVGERASKAKVTLLVGHDSNIASLLTALDFKPYQLPGQYERTPIGGKLLFQRWHDSAG
NRDLMKIEYVYQSTEQLRNADALTLQAPPQRVTLALNGCPVDDQGFCPLETFKKVINEAA
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggatgaagggatgaaaaaacgtctacttgccgccgccgttgccggcgcggtg
atgttatccgctggcgctcaggcgcaggacacggccgccccggaggggtatcagctgcag
caggtgctgatcatgagtcgtcacaacctgcgtgcgccgttggccaataacggcagcgtg
ctggagcagtccaccgccaaggcctggccgcagtgggatgtgccgggcggccagctgacc
accaaaggcggtgtgctggaggtgtatatgggccactatatgcgcgaatggctggcgcag
cagaagctggtgaccagcggcgagtgcccgccggaaaacgcggtttatgcctacgctaac
agcctgcagcgcaccgtcgccaccgcgcagttctttatcaccggcgcgttcccgggctgc
ggcatcccggtgcatcaccagcctcagatgggcaccatggacccgaccttcaacccggtt
attaccgacgactccccggcgtttcgcgagaaagcgctgcaggcgatggaaaaagagcgc
cagggaatgcagttgaccgagagctacaagctgctggagacgatgatcgattaccgcaac
tcgccctcctgcaaagagaagaaggtctgttccctgagcgagggtaaagatacctttagc
gccggttatcagcaggagccgggagtgtccggaccgttgaaggtgggcaactcgctggta
gacgccttcaccctgcaatattatgaaggcttcccgaaagatcaggtggcgtggggggag
atcgccagcgataagcagtggcaagtgctgtcgaagctgaaaaatggctatcaggatagt
ctgtttacctcggtggcggtggcgcaaaacgtcgccaaaccgctggttaaatatatcgat
aacgcgctggtgggcgagagagccagcaaggcgaaagtcacgctgctggtgggacacgac
tcgaatatcgcttcgctgctcaccgccctggactttaagccctatcaactgcccggccag
tatgagcgcactcctatcggcggcaaactgctgtttcagcgctggcatgacagcgccggc
aatcgcgatctgatgaagattgagtatgtctatcaaagtaccgagcaactgcgtaacgcc
gacgcgttaaccctgcaggccccgccgcagcgggtcactctggcgcttaacggctgtccg
gttgatgaccagggattctgcccgctggagacctttaaaaaggtgatcaacgaggcggcg
aaataa

DBGET integrated database retrieval system