KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_12770Help
Entry
KPNIH27_12770     CDS       T03370                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00071  Fatty acid degradation
kpz00072  Synthesis and degradation of ketone bodies
kpz00280  Valine, leucine and isoleucine degradation
kpz00310  Lysine degradation
kpz00362  Benzoate degradation
kpz00380  Tryptophan metabolism
kpz00620  Pyruvate metabolism
kpz00630  Glyoxylate and dicarboxylate metabolism
kpz00640  Propanoate metabolism
kpz00650  Butanoate metabolism
kpz00900  Terpenoid backbone biosynthesis
kpz01100  Metabolic pathways
kpz01110  Biosynthesis of secondary metabolites
kpz01120  Microbial metabolism in diverse environments
kpz01130  Biosynthesis of antibiotics
kpz01200  Carbon metabolism
kpz01212  Fatty acid metabolism
kpz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH27_12770
   00630 Glyoxylate and dicarboxylate metabolism
    KPNIH27_12770
   00640 Propanoate metabolism
    KPNIH27_12770
   00650 Butanoate metabolism
    KPNIH27_12770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNIH27_12770
   00072 Synthesis and degradation of ketone bodies
    KPNIH27_12770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNIH27_12770
   00310 Lysine degradation
    KPNIH27_12770
   00380 Tryptophan metabolism
    KPNIH27_12770
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPNIH27_12770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNIH27_12770
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH27_12770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpz04147]
    KPNIH27_12770
Enzymes [BR:kpz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPNIH27_12770
Exosome [BR:kpz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH27_12770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIA42159
Position
complement(2639285..2640475)
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQVEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRDTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgccaactgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgtggttccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggtcgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccatggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttt
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggagggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcgacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggagcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaatgaggct
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtctcgacccggcccgcgttaac
gtcaacggcggcgcgatcgctctcggccacccggtaggcgccagcggtgcgatcctgccg
gtcaaactgatgtatgaaatggcgcgcagcggtgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system