KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_23465Help
Entry
KPNIH27_23465     CDS       T03370                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00010  Glycolysis / Gluconeogenesis
kpz00020  Citrate cycle (TCA cycle)
kpz00620  Pyruvate metabolism
kpz01100  Metabolic pathways
kpz01110  Biosynthesis of secondary metabolites
kpz01120  Microbial metabolism in diverse environments
kpz01130  Biosynthesis of antibiotics
kpz01200  Carbon metabolism
Module
kpz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH27_23465
   00020 Citrate cycle (TCA cycle)
    KPNIH27_23465
   00620 Pyruvate metabolism
    KPNIH27_23465
Enzymes [BR:kpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     KPNIH27_23465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_25
Motif
Other DBs
NCBI-ProteinID: AIA44184
Position
4814250..4815872
Genome map
AA seq 540 aa AA seqDB search
MRVNHGLTPQDLKAYGINDVQDIVHNPSYDMLFQEELDPNLEGYERGVLTTLGAIAVDTG
IFTGRSPKDKYLVRDDTTRDTVWWSDKGKGKNDNKPLSQETWQHLKGLVTQQLSGKRLFI
VDAFCGANADTRLSVRFITEVAWQAHFVKNMFIRPSDEELAEFEPDFIVMNGAKCTNPQW
KEQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEK
GDVAIFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSEAAEPDI
YHAIRRNALLENVVVRADGTVDFDDGSKTENTRVSYPIDHIDNIVKPVSKAGHATKVIFL
TADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQ
YAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNL
QIPTALPGVDTHILDPRSTYGSPEQWQEKADQLAKLFIENFEKYTDTPAGAALVAAGPQR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaatcatggtttaaccccgcaggatctcaaggcttatggtatcaatgacgtc
caggatatcgtccacaaccccagctacgacatgttgtttcaggaagagctcgacccgaac
ctggaaggctacgaacgtggcgtattaaccactctgggtgctatcgccgtcgacacgggc
atttttaccggtcgttctccgaaagataagtatctcgtgcgcgacgacaccacccgcgac
accgtctggtggtccgataaaggcaaaggtaaaaacgacaacaagccgctttcgcaggaa
acctggcagcatctgaaagggctggtgacccagcaactgtccggtaaacgcctgtttatc
gtcgacgctttctgcggcgccaacgccgatacccgtctcagcgtacgtttcattaccgaa
gtggcctggcaggcgcacttcgttaaaaacatgttcatccgtccgagcgatgaagagctg
gctgaattcgagcccgacttcatcgtgatgaacggcgcgaaatgcaccaatccgcagtgg
aaagagcagggcctcaattcggaaaacttcgtcgccttcaacctcaccgagcgcattcag
ttgatcggcggcacctggtacggcggcgagatgaagaaagggatgttctcgatcatgaac
tacctgctgccgctgaagggcatcgcctccatgcactgctcagccaacgtcggcgagaaa
ggcgatgtcgccattttcttcggcctctcaggcaccggcaaaaccaccctctccaccgac
ccgaaacgccgcctgattggcgatgacgaacatggctgggatgacgacggcgtgtttaac
ttcgaagggggctgctacgccaagaccatcaagctctctgaagcggccgagccggatatc
tatcacgccatccgccgcaacgccctgctggaaaacgtggtggtacgcgccgacggcacg
gtcgatttcgatgacggttcaaagaccgaaaatacccgcgtctcctaccccatcgaccac
atcgacaacattgttaagccggtgtctaaagcgggtcacgctaccaaagtgatcttcctg
acggccgatgcgttcggcgtcctgccgccggtctcccgcctgaccgccgaccagacgcag
taccatttcctgtccgggtttaccgccaaactggccggcaccgagcgcggcgtaaccgaa
cccacgccaaccttctccgcctgcttcggcgccgccttcctgtcgctgcacccgacgcag
tacgccgaagtgctggtcaaacgcatgcaggcggctggcgcacaggcttatctggtcaat
accggctggaacggcaccggcaagcgcatctcgattaaagatacccgcgcgatcatcgac
gccatcctcaatggctcgctggacaacgcggagacctttaccctgccgatgtttaacctg
cagatcccgacggcgctcccgggcgtggatacccacatcctcgatccgcgcagcacctat
ggttccccggagcagtggcaggaaaaagccgaccagctggcgaagctgtttattgagaat
tttgagaagtataccgatacgccagcgggcgccgcgctggtggcggcaggaccgcagcgc
taa

DBGET integrated database retrieval system