KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_29505Help
Entry
KPNIH27_29505     CDS       T03370                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00561  Glycerolipid metabolism
kpz00640  Propanoate metabolism
kpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPNIH27_29505
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    KPNIH27_29505
Enzymes [BR:kpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     KPNIH27_29505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AIA45328
Position
pKPN-a41:60063..61148
Genome map
AA seq 361 aa AA seqDB search
MQAQNIIFPAQILRGAGAVSRIGEVCGLLGSRALIIGGHSGLAAVEAHIRYQLAASSVTV
VGREWFGGVCSESHIHRLAQVVQATGADLVIGVGGGKALDTSKAVGVETRVPVVTVPTIA
ATCAAVTPLTVRYHDDGHFRDLFPLNQAPAVVIIDTEIIAAAPLRWLAAGLGDTLAKWYE
FRAISAGLDNHSGIARASIANSRICYDLINTHGPAACDAVRKGVPDAALEQVLDAIFMFA
GLTSLMSSGAHAAAAHAIYEGFTVCDKTREFGHGLLVGFGNLCLLALENRSDEELLEAIG
LARACAIPLSLREIAELDSTELAGIIDMALHAPDMANMPAPVTAGALYSAIARVEHQAGL
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcacaaaatattatcttcccggcgcagatcctgcgtggcgcaggtgcggtttcg
cgtatcggtgaggtctgcggattattgggttcacgggcgctgattatcggcggccatagt
ggcctggcggcggtggaagcgcatatccgctatcaactggcggcatcatcggtgacggtg
gttggccgggagtggtttggcggcgtgtgcagcgaaagccatattcatcgtctggcgcaa
gtggtgcaggccaccggcgcagacctggtcattggcgtgggtgggggaaaagccctggat
accagtaaagccgtgggcgtggagacccgtgtcccggtggtcaccgtgccaaccattgcg
gcaacctgcgcggcggtgacgccactcactgtccgttatcacgatgacggccattttcgg
gatctctttccactgaatcaggcgcctgctgtggtgattattgacacagaaatcatagcc
gccgcgccgctgcgctggttggcggcaggccttggcgatacactggcgaaatggtacgag
tttcgcgctatcagcgccgggctggacaatcacagcggtatcgcccgggcgtccattgcc
aacagccgtatctgctatgacctgatcaatacccacggccccgccgcctgcgatgcagtt
cgcaaaggggtgcccgatgctgcgctggagcaagtactggatgcgatatttatgtttgcc
ggactgacctcattaatgagcagtggggcacatgctgctgccgctcatgcaatttatgag
gggtttaccgtatgcgataaaacccgcgaatttggtcatggcttattggtgggatttggc
aacctttgcctgctggcgctggagaaccgcagcgatgaggaattgctggaggccattggc
ctggcccgcgcgtgcgctatcccgctcagcctgcgggaaattgctgaactggacagcacg
gaactggcggggattattgatatggcattgcatgcgccggatatggcgaacatgccggct
ccggtcacagcgggcgcactgtatagcgccattgcgcgtgtggaacatcaggccgggttg
ttgtag

DBGET integrated database retrieval system