KEGG   Klebsiella quasipneumoniae: AVR78_05790Help
Entry
AVR78_05790       CDS       T04389                                 

Definition
(GenBank) sensor protein ZraS
  KO
K07709  two-component system, NtrC family, sensor histidine kinase HydH [EC:2.7.13.3]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AVR78_05790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kqu01001]
    AVR78_05790
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kqu02022]
    AVR78_05790
Enzymes [BR:kqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AVR78_05790
Protein kinases [BR:kqu01001]
 Histidine kinases
  NtrC family
   AVR78_05790
Two-component system [BR:kqu02022]
 NtrC family
  HydH-HydG (metal tolerance)
   AVR78_05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA sCache_3_2 HATPase_c_3 HATPase_c_5 HATPase_c_2 HPTransfase dCache_1 Spore_YhaL
Motif
Other DBs
NCBI-ProteinID: AMR13895
UniProt: A0A418QJI7
Position
4046688..4048082
Genome map
AA seq 464 aa AA seqDB search
MKIKPFSRDAAAGALSWLLTGTVVLLVVLFSAMIVRDYGRETTAARQTIEEKGSVLIRAL
ESGTRVGMGMRMHHVQLQALLEEMAWQPGVLWFAVTDDNGAIIAHSDPQQVGQTLYSPAQ
MRALAVGEQARWRRLSEPQPAMEIYRQFRPLNPARGHHMGMMNRGNSALAQASVPQVIFI
AFDSRELDAAQARGQRNMAIMLGAAALVTAATILAQFWFRRYRRSRKQLLEAMARKEKLL
ALGHLAAGVAHEIRNPLSSIKGLAKYFAERTPPGGESHQLAQVMAKEADRLNRVVSELLE
LVRPAHLNYQPVDINALIHHSLQLVSQDAQSRGIALQFTPRPELSTINADADRLNQVLLN
LYLNAMQAIGRDGVIHVSASEADRRRMKIVVKDSGKGMSDEELQAIFTPYFTTKADGTGL
GLAVVQNIIEQHGGTIRAESQPGAGAIFTLWLPLDAQRREDEQR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaaacctttttcccgggacgctgccgctggcgcgctgagctggctgctgacc
ggtacggtagtgctgctggtggtgctgttctccgcgatgatcgtccgcgactacggtcgt
gagacgaccgccgcccgacaaactatcgaggagaaggggagcgtactgatccgcgcgctg
gagtccggcacgcgcgttggcatgggaatgcggatgcaccacgtgcagctgcaggccctg
ctggaagagatggcctggcagccgggcgtcctgtggttcgcggtgactgatgacaatggc
gccatcatcgcccacagcgatccgcagcaggtgggtcaaacgctctacagccccgcgcag
atgcgtgcgctggcggttggcgaacaggctcgctggcggcggcttagcgagccgcagccg
gccatggagatctatcgccagtttcgcccgctcaatccggcccgcggccaccatatgggc
atgatgaatcgcggcaacagcgccctggctcaagccagcgtcccgcaggtgatttttatc
gcctttgatagccgcgagctggatgccgcgcaggcccgcgggcagcggaatatggccatc
atgctgggcgccgccgcgttggtgacagcggcaacgatccttgcccagttctggttccgc
cgctatcgccgctcacggaaacaactgctggaggcgatggcccgcaaagagaaactgctg
gcgcttggccatctggcggcaggcgtggcgcacgagatccgcaatccgctctcgtcgatt
aaagggctggcaaaatattttgccgagcgcacgccgccgggcggtgagtcacatcagtta
gcgcaggtgatggccaaagaggccgaccgcctcaatcgggtggtcagtgagctgctggag
ctggtccggcccgcgcatttaaattaccagccggtggatattaacgcgcttatccaccac
tcattgcagttggttagccaggatgcgcagagtcgcgggatcgcgctgcaatttacgccg
cgcccggagctctccacgatcaacgccgatgccgaccgcctgaaccaggtgctgttgaac
ctgtacctgaacgcgatgcaggcgattggccgcgacggcgtcattcacgtatcggcaagt
gaagccgatcggcgacgtatgaaaatagtcgttaaggatagcggtaaggggatgagcgat
gaagagctacaggccatcttcactccttatttcaccaccaaggcggacggcaccgggctg
gggctggcggtggtgcagaatattatcgaacaacatggcgggacgatccgcgccgaaagt
cagccgggggctggagcgatatttacgctttggctaccgctggatgctcaacggagggaa
gatgagcagcgataa

DBGET integrated database retrieval system