KEGG   Klebsiella quasipneumoniae: AVR78_09670Help
Entry
AVR78_09670       CDS       T04389                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00010  Glycolysis / Gluconeogenesis
kqu00020  Citrate cycle (TCA cycle)
kqu00620  Pyruvate metabolism
kqu01100  Metabolic pathways
kqu01110  Biosynthesis of secondary metabolites
kqu01120  Microbial metabolism in diverse environments
kqu01130  Biosynthesis of antibiotics
kqu01200  Carbon metabolism
Module
kqu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AVR78_09670
   00020 Citrate cycle (TCA cycle)
    AVR78_09670
   00620 Pyruvate metabolism
    AVR78_09670
Enzymes [BR:kqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AVR78_09670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding SLD3
Motif
Other DBs
NCBI-ProteinID: AMR14594
Position
complement(4853867..4855402)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
ILAREGETLQVGAVLALAADASVSDAELDDFAASLASAKPAVPGTESAAPGVAAQAGAKP
ASIVSPPSNSPEPPVGQTDIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGD
RISVSDLKSAIVAAGGRLASPTPPVRRSKAPRSHADDSQVSATPLARRLACKLGINLHDC
RSSGSRGRVSRDDVLAATLLLDEQPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLNVDLDLERLLALRQDINREVPGAKISVNDLLVKACALALVAVPDVNIQFDEATQ
SIRRFADADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSVSNLGMLGVRQFDAIINPPQSAILAIGAGELRAVVSDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIEIPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatctgcgag
attgaaaccagtaaaatcgtcaatgtgctggaggcaccctttgccggtacgttacgtcgg
atactcgcccgcgagggtgagacgcttcaggtaggcgccgtgctggccctggcggctgac
gcgtcggtcagcgatgctgaactggacgattttgctgccagcctggcttcggcgaaaccc
gcagtccctggcacggagtctgccgcgccgggcgtagcggcacaggcaggcgctaagcca
gcttccattgtttccccgccatccaacagccccgagccccctgttgggcagaccgatatc
cccgtcagtctgcaaggcgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
agactgtctgcccgctggggtgtcgacctgaaaaaagtccgcggcagcgggcgcggggat
cgtatctctgtttctgatctgaaaagcgcgatcgttgccgccggcggtcgtctggcctct
ccgacgccccccgttcgtcgcagcaaagcgccccgctcgcatgccgatgatagccaggta
tcggccaccccgctggcgcgccgtctggcctgcaaactgggtatcaacttacatgactgc
cgaagcagcggttcacgcggtcgggtgagtcgcgatgatgtgctggccgcaacgttgtta
ctcgacgagcaaccgcagaccagccctgtgcaggagagtgccccggcaccctttgagagc
atcccgatgtccggtatgcggcgggctatcgcttctcgcctgcaaacgtccaagcaacag
tctccccatttccgtttgaacgtcgatctcgatctggaacgactgttagcgttacgtcag
gacattaaccgcgaagtacccggcgccaagatttcggttaatgacctgctggtgaaggcc
tgcgccctggctctagtggccgtgcctgacgtcaacatccagtttgatgaagcgacacaa
agtatccgccgctttgcggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgattagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcgtgtcaaatctgggaatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgagctccgggcggtagtaagcgac
gggcaaatcgtcgcgcgccagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaatcccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system