KEGG   Klebsiella quasipneumoniae: AVR78_11085Help
Entry
AVR78_11085       CDS       T04389                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00052  Galactose metabolism
kqu00500  Starch and sucrose metabolism
kqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AVR78_11085
   00500 Starch and sucrose metabolism
    AVR78_11085
Enzymes [BR:kqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AVR78_11085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AMR14860
Position
complement(5136367..5137767)
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADDHYPQWHLAPVSGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGTLTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLRDWRLVGEIAGHDVNGLANGGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGAFDHGPLHELDSGFEFYAPQTMLAEDGRRLLVGWMGV
PDGEEMHQPTRAQGWIHQMTCVRELEWRSGALYQRPLRELTALRGEAQGWRGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLQIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgcctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacgaccattacccgcaatggcatctggcgccggtcagcggactgctgaac
gatcccaacggcttttgccaggtcgccgggcgttatcacctgttttatcagtggaacccg
ctcgcctgcgaccacacctataagtgctggggacactggagctcagccgacctgctgcac
tggcggcatgaacctatcgccctgatgccggatgaagagtatgaccgcaacggctgctac
tccggcagcgcagtcgagttcgagggtaccctgaccctgtgctacaccggcaacgtgaag
ttccccgacggcgggcgcaccgcctggcaatgtctggcgacggaaaatgccgatggcacc
ttccgcaagctggggccggtactgccgctgccggaaggctataccggccatgtacgtgac
cctaaggtgtggcgccaggacgggcgctggtacatggtcctcggggcgcaggatgtgcaa
cagcgcggcaaagtgctgctgtttaccgccagcgacctgcgggattggcgcctggtgggc
gagatagccgggcatgacgttaacggcctggcgaacggtggctacatgtgggagtgcccg
gacctgtttccgctggcggacacccacctgctgatctgctgcccgcaggggctggcccgc
gaagcacagcgttttctcaatacctatcctgcggtgtggatggcaggccgtttcgacgcc
gaacgcggcgccttcgaccatggcccgctgcacgagctggacagcggatttgagttctac
gcgccgcagaccatgctggccgaagatggccgccgcctgctggtcggctggatgggcgtc
ccggacggggaagagatgcatcagcccacacgcgcgcagggatggatccaccagatgacc
tgcgtgcgcgaactggagtggcggtcgggtgccctgtatcagcgtccgctgcgcgaactg
accgccctgcgcggggaagcccagggctggcgcgggcagaccctgcccctcgccccgatg
gagctggcctttgacatcgcccccaacagcacgctggggctggattttgccggcgccctg
cagctcaccgtcaaccgcgacggcctgcgcctgtcgcgccgcggcctgcagacggcggag
atgcatcatcgctactggcgcggcgaggcgcggcggctgcagatctttatcgaccgctcc
agtgtggaaattttcatcaacgatggcgaaggggtaatgagcagccgcttcttcccgggc
tatccggggcagctcatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagaataa

DBGET integrated database retrieval system