KEGG   Klebsiella quasipneumoniae: AVR78_16530Help
Entry
AVR78_16530       CDS       T04389                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00071  Fatty acid degradation
kqu00072  Synthesis and degradation of ketone bodies
kqu00280  Valine, leucine and isoleucine degradation
kqu00310  Lysine degradation
kqu00362  Benzoate degradation
kqu00380  Tryptophan metabolism
kqu00620  Pyruvate metabolism
kqu00630  Glyoxylate and dicarboxylate metabolism
kqu00640  Propanoate metabolism
kqu00650  Butanoate metabolism
kqu00900  Terpenoid backbone biosynthesis
kqu01100  Metabolic pathways
kqu01110  Biosynthesis of secondary metabolites
kqu01120  Microbial metabolism in diverse environments
kqu01130  Biosynthesis of antibiotics
kqu01200  Carbon metabolism
kqu01212  Fatty acid metabolism
kqu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AVR78_16530
   00630 Glyoxylate and dicarboxylate metabolism
    AVR78_16530
   00640 Propanoate metabolism
    AVR78_16530
   00650 Butanoate metabolism
    AVR78_16530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AVR78_16530
   00072 Synthesis and degradation of ketone bodies
    AVR78_16530
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AVR78_16530
   00310 Lysine degradation
    AVR78_16530
   00380 Tryptophan metabolism
    AVR78_16530
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AVR78_16530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AVR78_16530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AVR78_16530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kqu04147]
    AVR78_16530
Enzymes [BR:kqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AVR78_16530
Exosome [BR:kqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AVR78_16530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMR15847
Position
954714..955919
Genome map
AA seq 401 aa AA seqDB search
MNKVYIVAACRTPVGRFLGALKTVSAVELAALTVRHNLQQAGIDPAWIDEVICGCVLAAG
QGMGPARQVALRAGIPVQTPAYTLNMICGSGMKSMTEGAIHIQSGYADLVVAGGMENMSQ
APFLLQGEIRGGMKFGAFSSEDVIQRDGLTDPLLQIPMGETAEAIAAQEQISRAAQDQYA
LESHQKASAASRAGYFADEIVPVTVSAKRGVSTVREDEPIRHDLSAGQLAALKPAFRADG
SVTAGNASGLNDGAASVILASARAVARYGLQPLAEIVSFGEGGVDPSMMGLGPLPAIACA
LRRGGFQLSDMARLEINEAFAAQVLGVVRGLAREHQMTEEEIASRLNVHGGAIALGHPLG
SSGTRIVVSLLHALRRENQPTGLASLCIGGGMGIALLVKTI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagtctatatcgtcgcggcctgccgtacgccggtggggcgctttcttggcgcc
ctgaaaacggtctccgcggtggagttggcagcgctcaccgtcaggcacaacctgcagcag
gccggcattgacccggcgtggatcgatgaggtgatctgcggctgcgtcctcgccgccggg
cagggaatgggaccggcgcgtcaggttgcgctgcgggcagggatcccggtgcaaacgccg
gcttacaccctgaatatgatctgcggtagcggcatgaaaagcatgaccgaaggggcgatc
catatccagagcggttatgccgacctggtggtcgccggcggaatggaaaatatgagtcag
gcgccgtttttgctgcagggagagataaggggcgggatgaaattcggcgcattcagcagt
gaggatgtgatccagcgcgacgggttaaccgatccgctgctgcagatcccgatgggggaa
acggcggaggccatcgccgcgcaggagcagatctcgcgcgcggcgcaggaccagtatgcg
ctggagagccatcaaaaagcctccgccgccagccgtgccggctattttgccgatgagatt
gtgccggtgacggtaagcgcgaagcggggcgtcagcacggtccgcgaggatgagccgatc
cgccatgatcttagcgccgggcagctggcggcgctgaaacctgcttttcgcgctgacggc
agcgtcacggcgggcaacgcctccgggctgaacgatggcgccgcgtcggtgatcctcgct
tcggcgcgcgccgttgcccgctatggcctgcagccgctggcggagatcgtctcctttggc
gaaggcggcgtcgatccgtccatgatggggctcggcccactgccggcgatagcgtgcgcc
ctgcgccgcggtggttttcagctcagcgatatggcccggctggagattaacgaagccttt
gccgcgcaggtattgggggtggtcaggggactggccagagagcatcagatgacggaggag
gagattgcttcccgcctgaacgtccacggcggcgcgatcgccctcggtcacccgctgggc
agttccgggacgcggatcgtggtcagtctgttgcacgcgctacgccgggagaatcaaccg
accggcctggcgtcgctgtgcatcggcggcgggatggggattgcgttactggtgaaaacg
atctga

DBGET integrated database retrieval system