KEGG   Klebsiella quasipneumoniae: AVR78_16600Help
Entry
AVR78_16600       CDS       T04389                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00620  Pyruvate metabolism
kqu00630  Glyoxylate and dicarboxylate metabolism
kqu01100  Metabolic pathways
kqu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AVR78_16600
   00630 Glyoxylate and dicarboxylate metabolism
    AVR78_16600
Enzymes [BR:kqu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AVR78_16600
    1.2.1.22  lactaldehyde dehydrogenase
     AVR78_16600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AMR15860
UniProt: A0A383PVZ7
Position
969654..971093
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHQMYIDGQFVSGHGDGWIDVLNPATEALLSRIPDGTAEEARLAIDAAERAQPAW
EALPAIERAGWLRKIAAGIRQRADDIAGLIVAEGGKIQQLAAVEVAFTADYLDYMAEWAR
RYEGEIVQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEF
TPNNAIAFAEIVHQVGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVAAGEKIMAA
AAKNITKVCLELGGKAPAIVMDDADVELAVKAVVDSRVINTGQVCNCVERVYVQQGIYDR
FVNRLGEAMKAVQFGDPAARDDIAMGPLINAAARDQVARKVAKAVAQGARVALGGQPLEG
KGYFYPPTLLLDVRQEMDIIHEETFGPVLPVVAFSTLDEALAMANDSDYGLTSSIYTRDL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLNEYLQTQVVYLQA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccgttcaacaccagatgtatattgatggccagttcgtttccggtcacggc
gacggctggatcgacgtgcttaacccggcgaccgaagcgctgctgtcgcggatcccggac
gggaccgcggaagaggcgcggctggcgattgacgcggcggagcgcgcccagccggcctgg
gaggcgctgccggccattgagcgcgcgggctggctgcgcaaaattgccgccggcatccgt
cagcgtgccgatgacatcgccgggctgatcgtcgctgaaggcggcaagatccagcagctg
gcggcggtggaggtggcgttcaccgccgactatctcgactacatggccgaatgggcgcgg
cgttatgaaggggagatcgtgcagagcgaccgtcccggggaaaatatccttgtcttcaaa
cgcgcgctgggggtgaccaccgggatcctgccgtggaacttcccgttttttcttatcgcc
cgcaagctggcgccggcgctgatcaccggaaataccatcgtcattaagcccagcgaattc
acgcccaataacgctattgctttcgccgagatcgtccaccaggttgggctgccgaaaggg
gtctttaacctggtgctcggccgtggggaaaccgtcggccaggagctggccggcaatccg
aaggtggcgatggtcagcatgaccggcagcgtggcggcgggggagaaaatcatggccgcc
gcggcgaaaaatatcaccaaagtgtgccttgagcttggcggcaaagcgccggccatcgtc
atggacgatgcggatgtggagctggcggtgaaggcggtggtggactcgcgggtgatcaac
accgggcaggtgtgcaactgcgtcgagcgggtctatgttcagcaggggatttacgaccgc
ttcgtcaaccgcctcggcgaggcgatgaaggccgtgcagtttggcgacccggcggcgcgg
gatgacatcgcgatggggccgctgatcaacgctgccgcgcgggatcaggtggcgcgcaaa
gtggcgaaggcggtggcgcagggggcgcgggtagcgctgggcggtcagccgctggagggg
aaaggctatttttatccgccgaccctgctgctggatgtgcgtcaggagatggatattatc
catgaggaaaccttcggtccggtgctgccggtggtggcgttttcaactctcgatgaagcg
ctggcgatggccaatgacagcgattatggcctcacctcctcaatctacacccgcgatctc
aacgtggcgatgaaggcgattaaggggctgaagttcggcgaaacctatatcaaccgcgag
aactttgaggcgatgcagggattccacgccggctggcgtaaatcagggatcggcggcgca
gatggccgccatggcctgaatgagtacctgcagacccaggtggtctatctgcaggcctga

DBGET integrated database retrieval system