KEGG   Klebsiella quasipneumoniae: AVR78_19860Help
Entry
AVR78_19860       CDS       T04389                                 

Definition
(GenBank) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00270  Cysteine and methionine metabolism
kqu00450  Selenocompound metabolism
kqu01100  Metabolic pathways
kqu01110  Biosynthesis of secondary metabolites
kqu01230  Biosynthesis of amino acids
Module
kqu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AVR78_19860
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AVR78_19860
Enzymes [BR:kqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     AVR78_19860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 CNP1 Meth_synt_1 URO-D
Motif
Other DBs
NCBI-ProteinID: AMR16459
UniProt: A0A2A5MQZ0
Position
complement(1626469..1627500)
Genome map
AA seq 343 aa AA seqDB search
MKTWLPTSTAGSLPKPSWLAQPETLWSPWKLSSEELLAGKRDALRLSLDDQLRAGIDIVS
DGEQTRQHFVTTFIEHLSGVDFAKREIVKIRNRYEASVPTVVGAVERQKPVFVEDARYLR
QLTSQPIKWALPGPMTMIDTLYDNHYKSREKLAWEFAKILNQEAKELEAAGVDIIQFDEP
AFNVFFDEVNDWGIAALERATEGLKCETAVHICYGYGIKANTDWKKTLGSEWRQYEEAFP
QLQKSSLDIISLECHNSRVPMDLLELIRGKKVMVGAIDVASHAIETPEEVAATLRKALAF
VDADKLYPSTNCGMAPLPRQVATGKLHALSAGAEIVRRELAVK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatggcttccgacctccaccgctggcagtttaccgaaaccttcctggctggcg
cagccagagaccctgtggtcgccctggaaactgtccagcgaagaattactggccggcaag
cgcgacgccctgcgtttgtccctcgacgaccagctgcgggccgggatcgatattgtcagc
gacggcgagcaaacgcggcagcactttgtcaccacctttattgaacacctcagcggcgtt
gattttgccaaacgcgagatcgtgaaaattcgtaaccgctatgaggccagtgttccaacc
gtggtgggcgccgtagagcgccagaaaccggtcttcgttgaggacgcgcgctatctgcgt
cagctcaccagtcagccgattaaatgggcgttaccgggcccaatgaccatgatcgatacg
ctgtatgacaatcactataaaagtcgggaaaagctggcctgggagttcgccaaaatcctc
aatcaggaagcgaaagagttagaggccgccggggtcgatattattcagttcgatgagccg
gccttcaacgtcttcttcgatgaggtgaacgactgggggatcgccgcgctggaacgagcc
actgaagggctgaagtgcgagacggcagtgcatatctgctacggctacggcatcaaggcc
aataccgactggaaaaaaacgctgggctcagagtggcgtcagtatgaggaggccttcccg
cagctgcagaaatcgtccctcgatattatctctctcgagtgccacaactcgcgggtgccg
atggatctgctggagttgatccgcggtaaaaaggtgatggtcggggcgatcgatgtcgcc
agccatgcgattgaaactccggaagaggtggctgctaccctgcgcaaggcgctggcgttc
gtcgatgccgacaagctctacccctccaccaactgcggtatggcgccgctgccgcgccag
gtcgcgaccggcaaactgcacgccttaagcgccggtgccgagatcgttcgccgcgagctg
gcggtaaaataa

DBGET integrated database retrieval system