KEGG   Klebsiella quasipneumoniae: AVR78_21010Help
Entry
AVR78_21010       CDS       T04389                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AVR78_21010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kqu03400]
    AVR78_21010
Enzymes [BR:kqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     AVR78_21010
DNA repair and recombination proteins [BR:kqu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AVR78_21010
    RecFOR pathway proteins
     AVR78_21010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC DUF3882 NeuB
Motif
Other DBs
NCBI-ProteinID: AMR16668
UniProt: A0A1C1F560
Position
complement(1860359..1860880)
Genome map
AA seq 173 aa AA seqDB search
MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQ
PDFFAIEQVFMAKNADSALKLGQARGVAIVAATNQSLPVFEYAARQVKQTVVGIGSAEKS
QVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAAQISETRLNLARGRLR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggctattattctcggcattgacccggggtcgcgcgttaccggttatggcgtaatccgt
caggtcggccggcagctgagctaccttggcagcggctgtatccgcaccaaagtggacgat
ctgccgtcgcgcctgaagctgatctacgccggggtgacggagatcatcacccagttccag
cccgactttttcgccattgagcaggtctttatggccaagaatgccgactcggcgttaaag
ctcgggcaggcgcgcggggtggcgatcgtggcggcgaccaatcagtcgctaccggtgttt
gaatacgccgcccgccaggttaagcagacggttgtcggcatcggcagcgctgaaaagagt
caggtccagcacatggtgcgcactttgctcaagctgcctgccaatccgcaggcggatgcg
gcggatgcgctggcgatcgccatcacccattgccatgtcagccagaatgccgctcagatc
agcgagacccggctcaatctggcgcgagggcgcttacgataa

DBGET integrated database retrieval system