KEGG   Klebsiella quasipneumoniae: AVR78_25375Help
Entry
AVR78_25375       CDS       T04389                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00860  Porphyrin and chlorophyll metabolism
kqu01100  Metabolic pathways
kqu01110  Biosynthesis of secondary metabolites
kqu01120  Microbial metabolism in diverse environments
Module
kqu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AVR78_25375
Enzymes [BR:kqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     AVR78_25375
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     AVR78_25375
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     AVR78_25375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Shikimate_DH LSDAT_prok
Motif
Other DBs
NCBI-ProteinID: AMR17468
Position
complement(2762384..2763799)
Genome map
AA seq 471 aa AA seqDB search
MDYLPLFAELKQRPVLVIGGGEIAERKIKFLLRAQAQVQVVAGTLSPALADLAARQALSW
RATEFSDALVDDVFLVIAATEDEALNQRVFAAANARYRLVNVVDNQSLCSFVFPSIVDRS
PLLVAISSSGKAPVLSRILREKIEALLPTNLGRLAESASYWRNHLKTRLTTTEARRRFWE
RVFTGRFASLMVAGNAAEAEKALQDELDKPERETGEIILVGAGPGDAGLLTLRGLQAIQQ
ADVVFHDHLVTQPVLELVRRDAELVCVGKRAGEHSVPQHETNQLLVEAAKAGKTVVRLKG
GDPFIFGRGAEELQAAAAAGIPFQVVPGVTAAAGATAYAGIPLTHRDYAQSAVFVTGHYK
PDSAPFDWALLAKSQQTLAIYMGTMKAAEISAQLIAHGRDSNTPVAVISRGTRDDQQTIT
GTLQQLEHLAKDAPMPALLVVGEVVQLHQQLAWFQHTSSAEGFNSSVVNLA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtggattacttgcccctttttgccgaactgaaacaaaggcccgtactggtgatcggcggc
ggtgagattgccgagcgcaagatcaagttcctgctgcgagcccaggcgcaggtgcaggtg
gtcgccgggacgttgtctccggcgctggccgatctggcggcgcgccaggcgcttagctgg
cgggcgacggaatttagcgacgctctggtggacgatgtctttctggtgattgccgccacg
gaggacgaggcgcttaaccagcgggtgtttgcggcggctaacgcgcgctaccgactggtc
aacgtagtggataaccagtcgctgtgctcgtttgttttcccttctatcgtcgaccgttcg
ccgctgctggtggcgatctcctccagcgggaaagcgccggtgctgtcgcgcattctgcgc
gaaaaaatcgaagcgctgctgccgacgaacctcgggcgtctggcggaatcggcgagctac
tggcgcaaccatctgaaaacccgtctgacgaccaccgaagcgcgtcgccgcttttgggag
cgggtctttaccggtcgcttcgccagcctgatggtggcgggcaacgctgcggaggcggaa
aaggcgctgcaggatgagctggataagcccgaacgcgaaacgggtgaaattattctggta
ggggccggaccgggcgatgccgggctgctgaccctgcgtggcttgcaggcgatccagcag
gcggacgtggttttccacgatcatctggtgacccagccggttctcgagctggtgcgccgc
gatgccgagctggtttgcgtcggcaaacgcgccggcgagcactcggtgccgcagcatgaa
accaatcagctgctggtggaggcggcgaaggcggggaaaaccgtcgtgcgcctgaaaggc
ggcgatccgtttatttttggccgcggcgctgaagagctgcaggccgccgccgctgcgggc
atcccgttccaggtggtgccaggcgtcactgccgccgccggcgcgacggcctacgccggt
attccgctgacccatcgcgattatgcgcaaagcgccgtctttgtcaccgggcactataag
ccggacagcgcccccttcgactgggcgctgttggcgaagagccaacagacgctggcgatt
tacatgggcaccatgaaggcggcggaaatcagcgcccagctgattgcccacggtcgcgac
agcaatacgccggtagcggtgatatcccgcggtacccgcgacgatcagcagacgataacc
ggcacattgcaacaactcgaacacctggcgaaagacgccccgatgcccgccctgctggtg
gtcggcgaagtggtgcagctgcatcagcagctcgcctggtttcaacatacatcatccgcc
gaggggtttaactcttcggtggtcaatctggcttaa

DBGET integrated database retrieval system