KEGG   Klebsiella quasivariicola: B8P98_01590Help
Entry
B8P98_01590       CDS       T05116                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00430  Taurine and hypotaurine metabolism
kqv00460  Cyanoamino acid metabolism
kqv00480  Glutathione metabolism
kqv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    B8P98_01590
   00460 Cyanoamino acid metabolism
    B8P98_01590
   00480 Glutathione metabolism
    B8P98_01590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kqv01002]
    B8P98_01590
Enzymes [BR:kqv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     B8P98_01590
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     B8P98_01590
Peptidases and inhibitors [BR:kqv01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   B8P98_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ASV18075
UniProt: A0A223U549
Position
330570..332315
Genome map
AA seq 581 aa AA seqDB search
MIKTTIWRQVVIAALLAGGSFTVAANPPPPPPVSYGVEEDVFHPVRARQGMVASVDALAT
RVGVDILRQGGNAVDAAVAVGYALAVTHPQAGNIGGGGFMMLRTKDGKTTAIDFREMAPE
QATRDMFLDDQGNPDSKKSLTSHLASGTPGSVAGFSLALEKYGTMPLNKVIRPAIKLAEE
GFIVNDALADDLKTYGSEVIPQHENSKAIFWKNGEPLKKGDRLVQKNLGKSLELIAEHGP
DAFYKGAIAEQIADEMKKHGGLITKADLASYKAVERTPVSGEYRGYEVYSMPPPSSGGIH
IVQILNILENFDMQKYGFGSADAMQVMAEAEKHAYADRSEYLGDPDFVNVPWQALTSKAY
AKAIAAEIDVNKAKPSSQIRPGKLAPYESNQTTHFSVVDKDGNAVAVTYTLNTTFGTGIV
AGDSGILLNNQMDDFSAKPGVPNVYGLVGGDANAAEPKKRPLSSMSPTIVVKDGKTWLVT
GSPGGSRIITTVLQMVVNTIDFGMNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEA
KGQKVALKEAMGSTQSIMVGPDGMLYGASDPRSPDDLTAGY
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaacaacaatatggcgtcaggtggtcatcgctgcattgctggcggggggtagt
tttaccgtcgccgccaatccgccgccaccgccgccggtctcgtatggcgtagaggaagat
gtgttccacccagtacgcgcccggcaggggatggtggcctcggtggatgcgctggccacc
cgcgtcggcgtagatattctgcgccagggcggcaacgccgttgatgcagcggttgccgtt
ggctacgcgctggcggtgacgcatccgcaggccgggaatatcggcggcggcgggtttatg
atgctgcgtactaaagacggtaaaaccacggcgatcgatttccgcgaaatggcgccggaa
caggccacccgcgacatgttccttgacgaccagggcaacccggacagtaaaaaatcactg
acttcgcatctcgcttccggtaccccaggcagcgttgcgggcttctccctcgcgctggaa
aagtacggcaccatgcctctgaacaaagtgatccgtccggcgattaagctggcggaagag
gggtttattgttaacgatgcgctggcggacgatctgaagacctacggcagcgaagtcatt
ccccagcatgaaaacagtaaagcgatcttctggaagaacggcgagccgctgaagaagggc
gatcggctggtgcaaaagaatctggggaaaagcctggagctaattgccgagcacggcccg
gacgccttctataaaggggccattgccgagcagatcgctgacgagatgaaaaagcatggc
gggcttatcaccaaagccgatctcgccagctataaggccgtcgagcgcacgccggttagc
ggtgaatatcgcgggtatgaggtctactccatgccgccgccgtcctccggcgggatccac
atcgtgcagatcctcaatatcctcgaaaacttcgatatgcagaaatatggctttggcagt
gccgacgccatgcaggtgatggcggaagcggagaagcatgcctatgccgaccgctctgaa
tatctcggcgaccctgatttcgtcaacgtgccgtggcaggcgctgaccagcaaagcctac
gccaaagcgatagccgccgagatcgacgtcaacaaggcgaagccttccagccagatccgt
ccgggcaagctggcgccgtatgaaagcaaccagaccacccacttctcggtggtcgataaa
gacggcaatgcggtggcggtgacctatacgctgaataccaccttcggtaccggcattgtg
gccggcgattccgggattttgctcaataaccagatggatgacttctcggcgaagcctggc
gtgcctaacgtctatggtctggtgggcggcgacgccaatgcggcggagccgaaaaaacgc
ccgctgtcgtcgatgtcgccgaccattgtggtgaaagacggcaaaacctggctggtgacc
ggcagcccgggcggcagtcggatcatcacgaccgtgctgcagatggtggtcaataccatc
gatttcgggatgaacgtcgcggaggccaccaacgcgccgcgcttccaccatcaatggctg
ccggacgagctgcgggtggagaaaggctttagcccggataccctgaagctgctggaggcg
aaggggcagaaagtggcgctgaaagaggcgatgggcagtactcagagcatcatggtgggg
ccggacggcatgctgtatggcgcctccgatccgcgttcgccggatgatttaacggcgggg
tattaa

DBGET integrated database retrieval system