KEGG   Klebsiella quasivariicola: B8P98_08280Help
Entry
B8P98_08280       CDS       T05116                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B8P98_08280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kqv02000]
    B8P98_08280
Transporters [BR:kqv02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    B8P98_08280
   Histidine transporter
    B8P98_08280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 MFS_Mycoplasma
Motif
Other DBs
NCBI-ProteinID: ASV19286
UniProt: A0A223U8D8
Position
1619735..1620421
Genome map
AA seq 228 aa AA seqDB search
MLYGFSQVILQGALVTLELALSSVVLAVLIGLAGAGAKLSSNRPLALVFEGYTTLIRGVP
DLVLMLLIFYGLQIALNSVTDALGMAQFDIDPMIAGIITLGFIYGAYFTETFRGAYLAVP
KGHIEAATAFGFSGGQTFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWQPFYFAIVCGLIYLVFTTLSNGVLLLLERRYTVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatgggttttcacaggttattttgcagggtgcgctcgtcactctggagcttgcg
ctcagctcggtcgttctcgccgttctgatcgggctggcaggcgctggcgcaaagctatcg
agcaatcgtccactggcgctggtgtttgaaggctataccactctgatccgcggcgtgccc
gatctggtgctaatgctgctgattttctacggtctgcaaattgcgcttaacagcgtcacc
gacgcgctgggaatggcgcagtttgatatcgacccgatgatcgcggggattattaccctt
ggctttatctatggcgcctattttacggaaacgttccgcggcgcctaccttgccgtacca
aagggacatatcgaagcggctaccgcctttggctttagcggcgggcaaacgttccggcgt
attctgttcccggcgatgatgcgctacgccctgccggggatcggcaacaactggcaggtt
atcctcaaggcgacggcgctggtctcgctgctggggctggaagatgtggtcaaagccacg
cagctggcggggaaaagcacctggcagccgttctactttgctatcgtctgcggcctgatt
tatctggtgtttaccactctttctaatggcgtattgctgctgctcgaacgccgctatacc
gttggcgtgaagagggctgacctgtga

DBGET integrated database retrieval system