KEGG   Klebsiella quasivariicola: B8P98_09325Help
Entry
B8P98_09325       CDS       T05116                                 

Definition
(GenBank) UDP-phosphate galactose phosphotransferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
kqv  Klebsiella quasivariicola
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kqv01005]
    B8P98_09325
Enzymes [BR:kqv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     B8P98_09325
Lipopolysaccharide biosynthesis proteins [BR:kqv01005]
 O-antigen
  B8P98_09325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: ASV19476
UniProt: A0A223U8X4
Position
1860559..1861989
Genome map
AA seq 476 aa AA seqDB search
MTRLARNFWTGASLALSDFIGFTIAIFFAVPLSKFAISDAETIILNSHINDWIFLHICLG
GCCVAWYSIRLRHYFYRKTFWFELKEILRTLVIFAVIEIAVMAFAHWEFSRIAWVVTWIS
VVILVPTFRMLTKEILDRSGLWKRQAIIVGNGDNAFEAWKAINSEKNLGFDVISFIAVEE
GTSDTKSISNIPVICCSPATLPEYVDKRTQFIVALETSQGNIRNAWLRYFMINGFRYVSV
IPTLRGMPLDSTDMSFIFSHEVMIFRVHQNLAKLSSRILKRTFDIVGSLSIICALSPLLA
YIAYKVKSDKGPAIYGHERIGKNGKPFKCLKFRSMVINSKEVLEELLKSDSQAKAEWDAT
FKLKDDPRVTSIGKFLRKTSLDELPQLFNVLRGEMSLVGPRPIITAELERYSDEVDYYLL
GKPGMTGLWQVSGRSDVDYETRVYLDAWYVKNWSMWNDIAILFKTIGVVVKKDGAY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtttagcccgcaacttctggacaggtgcatctttagcgctgtccgattttatc
ggatttactattgcaatattttttgcggtaccattgtcaaaatttgcaatttctgacgct
gaaaccattattttaaattcacatattaatgactggattttccttcacatatgtcttggt
ggatgctgtgtcgcatggtattcaatacgtttacgacactatttttatcgtaaaactttc
tggttcgaattgaaagaaattctgcgaacgttagttatttttgccgttattgaaattgct
gttatggcatttgcacattgggagttctccagaatagcttgggtagtcacatggatctct
gttgtcattttggtgccaacattcagaatgttaacaaaagaaattcttgatagaagtgga
ttatggaagcgacaggctatcatagtgggtaatggtgacaacgcttttgaagcctggaag
gctattaatagtgagaaaaatttaggttttgatgttataagtttcattgcagtagaagag
ggaaccagtgacaccaagtcaataagtaatattccagtcatttgttgcagtcctgcaacc
ttgccagaatatgtagataaaagaacacagttcatagttgcattagagactagtcaagga
aatattcgtaatgcttggcttcgctactttatgattaatggttttagatatgtatctgta
attccaacattgcgcggaatgccgctggatagtactgatatgtcttttatttttagtcat
gaagtcatgatatttcgagtgcatcaaaatttagcaaaattatcttctcgaattttaaag
cgcacgtttgatattgttggttcattgtctattatatgtgcactttcaccacttcttgca
tatatagcatataaagtaaaaagcgataaaggtccagcaatttatggacatgaacgaatt
ggaaagaatggtaaaccatttaaatgcctaaaatttcgctcaatggtcataaattcgaaa
gaagttttagaagaactattgaaatcagattcccaagcgaaggctgaatgggatgcaact
tttaagcttaaagatgatccgcgtgttacaagtattggtaagtttttgcgcaaaacaagc
ttggatgaacttccgcaactttttaatgtactccgaggtgaaatgagtttagttggacca
aggcctatcattactgcagaacttgaacgttattccgatgaggtggattattacttactt
ggtaaaccgggaatgactggcctatggcaagttagtggtcgaagtgatgttgattatgaa
acacgtgtttacctggatgcatggtatgttaagaattggtcaatgtggaatgatattgct
atattatttaaaactataggggtagtagtgaaaaaggatggcgcctattaa

DBGET integrated database retrieval system