KEGG   Klebsiella quasivariicola: B8P98_16305Help
Entry
B8P98_16305       CDS       T05116                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00450  Selenocompound metabolism
kqv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B8P98_16305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kqv03016]
    B8P98_16305
Enzymes [BR:kqv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     B8P98_16305
Transfer RNA biogenesis [BR:kqv03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    B8P98_16305
 Prokaryotic Type
    B8P98_16305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ASV20741
UniProt: A0A223UCJ4
Position
complement(3277747..3278790)
Genome map
AA seq 347 aa AA seqDB search
MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETSDDAAVYDLGNG
TSIVSTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINTLAPEIARD
VVEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTERIKKNSTAQAGCKLYLTKPL
GIGVLTTAEKKSLLKPEHQGLATETMCQMNLAGAAFAAVDGVKAMTDVTGFGLLGHLSEV
CRGAGVQAQLRYADIPKLPGVEEYIAAGAVPGGTGRNFASYGHLMGEMPTEWRDLLCDPQ
TSGGLLLAVTPEAEAEVQAAAAQFGIKLAAIGELVTARGGRPMIEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaagccattcgtttaacgcaatacagccacggagccggttgtggttgtaag
atttccccgaaagtactggaaactatcctgcatagcgagcaggcgaagtttgtcgacccg
aacctgctggtcggcaacgaaaccagcgatgatgctgccgtttacgatcttggcaacggc
acgtccatcgtcagcaccaccgatttctttatgccgattgtcgataatccgttcgacttt
ggccgcatcgccgccaccaacgccatcagcgatatattcgccatgggcgggaaaccgatt
atggcgattgccatccttggctggccaatcaacaccctggcgccggaaatcgcccgcgac
gtggtggagggtgggcgctttgcctgccagcaggccgggatcgcgctggcgggcggccac
tccatcgatgctccggaaccgatcttcggtctggcggtcaccggcgtggtgcccaccgag
cgcatcaagaaaaacagcaccgcccaggcgggctgcaaactgtatctcaccaaaccgctg
gggatcggcgtactgaccaccgcggagaaaaaatcgctgctcaagccggaacatcagggg
ctggcgacagagaccatgtgccagatgaacctcgccggcgccgcgtttgccgccgtcgac
ggggtgaaggcgatgaccgacgtcactggctttggcctgcttggccacctcagcgaggtg
tgccgcggagcgggcgtgcaggcgcagttgcgctatgccgatatcccgaaactgccgggg
gtggaggagtatatcgccgccggcgcggtgccgggcggcaccgggcgcaactttgccagc
tacggccatctgatgggcgagatgccgacggagtggcgggatctgctgtgcgatccgcag
acttccggcggcctgctgctggcggtgaccccggaagcggaagccgaagtacaggccgcc
gcggcgcagttcggcattaagctggccgccatcggcgagctggtgaccgcccgcggcggg
cgacccatgatcgagatccgttga

DBGET integrated database retrieval system