KEGG   Klebsiella quasivariicola: B8P98_17625Help
Entry
B8P98_17625       CDS       T05116                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
kqv  Klebsiella quasivariicola
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B8P98_17625
Enzymes [BR:kqv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     B8P98_17625
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     B8P98_17625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Rapsyn_N
Motif
Other DBs
NCBI-ProteinID: ASV22955
UniProt: A0A223UIX3
Position
complement(3497472..3498479)
Genome map
AA seq 335 aa AA seqDB search
MSAEKKPVVAITIGDPAGIGPEITVATMMDKSVYDECKPFLIGSVPIISRAMKIMGCDFA
IHKIAHPQEARFSWGTLDVLETGDYDCDSIEWGKVQKLAGQMSLDYVMKSIELGKAGLID
VVSTAPIHKEAIKLAGCKLPGHTEIYQVETQSDYGLTMFHVHNLRVFFVSRHMALKAACD
YANKARVLACVQQIHHEFTALNINNPRIAVAALNPHGSDNGLFGHEEADNLIPAVKAAQE
MGINAIGPVPADSVFHLGKQGRYDAILSLYHDQGHIACKTLDFERSITITFGLPFMRSSV
DHGTAFDIAGTGKAGTVSMLESTLVAARYWKMKHQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagagaaaaaacccgttgtggcgattaccatcggcgatccggcagggatcggc
cccgagatcaccgtggccaccatgatggacaaaagcgtgtatgacgagtgcaaaccgttc
ctgatcggctcggtaccgattatctcccgggcaatgaaaatcatgggctgcgattttgct
atccataaaattgcccatccgcaggaggcccgtttcagctgggggacgctggatgttctg
gaaaccggcgactacgattgcgacagcatcgaatggggcaaggtgcagaagctggcgggg
caaatgtcgctggactatgtgatgaagtcgatcgagctgggcaaagcgggactgatcgac
gtggtctcgactgcaccaattcataaggaagccatcaagctggcaggatgtaagctcccg
ggccataccgaaatctatcaggtggaaacccaatctgattacggtctgaccatgttccac
gtccacaacctgcgcgtcttcttcgtgagtcgtcatatggcgctaaaagcagcctgtgac
tatgccaacaaagcgcgggtgctggcctgcgttcagcagatccaccatgaatttaccgcc
ctgaacatcaacaatccgcgcattgccgtggccgcgctgaacccgcatggttccgacaac
ggtctgtttggtcacgaagaggctgacaatctgatcccggcagtgaaagccgctcaggag
atggggatcaacgctatcgggccggttccggccgattccgtgttccatctcggcaaacag
gggcgctacgacgccattctctcgctgtatcacgatcaggggcatatcgcctgcaaaacc
ctcgactttgaacggtcgatcaccattaccttcggtctgccgtttatgcgcagctccgtt
gaccatggaacggcgtttgatattgccggtaccggtaaggcaggtaccgtcagtatgctg
gagtcgacgctggtggcggcccgttactggaaaatgaagcatcaataa

DBGET integrated database retrieval system