KEGG   Klebsiella quasivariicola: B8P98_21700Help
Entry
B8P98_21700       CDS       T05116                                 

Definition
(GenBank) (2E,6E)-farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00900  Terpenoid backbone biosynthesis
kqv01100  Metabolic pathways
kqv01110  Biosynthesis of secondary metabolites
kqv01130  Biosynthesis of antibiotics
Module
kqv_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B8P98_21700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:kqv01006]
    B8P98_21700
Enzymes [BR:kqv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     B8P98_21700
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     B8P98_21700
Prenyltransferases [BR:kqv01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   B8P98_21700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: ASV21717
UniProt: A0A223UG34
Position
4287251..4288150
Genome map
AA seq 299 aa AA seqDB search
MDFPQQLQACVEQANGALRRFIAPQPFQNTPLVEAMHYGALLGGKRLRPFLVYATGAMFG
VSRTTLDAPAAAVECIHAYSLMHDDLPAMDDDDLRRGLPTCHIKFGEANAILAGDALQTL
AFSILSDAPMADVSDRDRLAMVSELAQASGVAGMCGGQALDLEAEGQQVDLQALERIHRH
KTGALIRAAVRMGALSAGERGRAALPALDRYAENIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARKKAHDLIADARRSLDELAAQSLDTSALEALANYIIQRDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggatttcccgcaacaattgcaggcctgtgtggaacaggctaatggggcattgcgccgt
tttatcgcgccgcagccctttcagaacactccgctggtggaagcgatgcattatggcgca
ctcttaggcggtaaacgcctgcgccccttccttgtctatgccaccggcgcgatgttcggc
gtcagccgcaccacgctcgatgcccccgccgcggcggtcgaatgtattcatgcttattcc
ctgatgcatgatgatttgccggcgatggatgatgacgatctgcgtcgcggactgccgact
tgtcatattaaatttggcgaagccaacgcaattcttgcgggagatgccctgcaaacgctg
gcgttctctatactgagtgatgcgccgatggccgacgtctctgatcgggaccggctggcg
atggtctccgaactggcgcaggccagcggcgtggcgggtatgtgcggcggccaggcgctg
gatctggaggcggaaggacagcaggtggatctgcaggcgctggagcgtatccatcgccac
aaaacgggggcgttgatccgcgccgccgtccggatgggggcgctgagcgccggcgaacgc
ggccgcgctgccctgcccgcgctggatcgctatgcggaaaatatcggtcttgccttccag
gtccaggatgacattctcgacgtggtaggggatactgcgacccttggcaaacgtcagggt
gccgaccagcaattgggtaaaagcacctatcccgccctcctgggtcttgagcaagcccgg
aagaaagcgcacgacctgatcgctgatgcccgccggtcgttagatgagctggccgcacaa
tctctggatacttcggcactggaagcgctcgcgaattacattattcagcgcgataaataa

DBGET integrated database retrieval system