KEGG   Klebsiella quasivariicola: B8P98_24155Help
Entry
B8P98_24155       CDS       T05116                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00040  Pentose and glucuronate interconversions
kqv00053  Ascorbate and aldarate metabolism
kqv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B8P98_24155
   00053 Ascorbate and aldarate metabolism
    B8P98_24155
Enzymes [BR:kqv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     B8P98_24155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASV22159
UniProt: A0A223UGR7
Position
complement(4791666..4793270)
Genome map
AA seq 534 aa AA seqDB search
MNASQTTAGRQFIAGRRIASGEATLLSLRAVDGEATGHRFYPASREEAAQAAEAAQQAFA
VYSQTTPQQRARFLNAIADELDTLGEAFFALAGQETALPLARLQGERARTSGQLRMFAGV
IQRGDTFAARIDTALADRQPLPRPDLRQYQQALGPVAVFGASNFPLAFSTAGGDTASALA
AGCPVVVKAHPGHMATAELTAEAIVRAVVRCGLPGGVFNMIFGTDIGAELVRHPAIQAVG
FTGSLAGGKALYQLAQQRPQPIPLFAEMSAINPLIILPQALQTRAEALANELVASFTLGG
GQFCTRPGLILALRGAGLERFKSALCATVAGSSPQVLLNAPTLQHYRQGVAALAVHPRIE
KLASGIAAGAGQAQTLLWQAQAEDLLAQDTLLQTEVFGPLSLLVEVDDMAQLQAVVKALQ
GQLTATLHAEADDGPLAASLLPLLCEKAGRVLFNGYPTGVEVCDAMVHGGPWPATTDARG
TSVGSRAIERFLRPVCLQNAPAALLPPALQDANPLNLLRLVNGQWTREAISSSH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcatctcagaccacggcgggacggcagtttattgccggacgccgcattgccagc
ggtgaggcgacgctattgagcctacgggcggtggacggcgaagccaccggccaccgcttt
tatccggcttcacgcgaggaagccgctcaggccgcagaagccgcgcagcaggcctttgcc
gtctattcacaaaccacgccgcagcagcgggcgcgctttctcaacgccattgcagatgaa
ctggatacgctgggcgaggcgttttttgcactcgccggacaggagaccgcgctgccgctg
gcgcggctgcagggtgaacgggcgcgcaccagcggccagctgagaatgtttgctggcgtg
attcagcgcggcgataccttcgccgcccgtattgataccgccttagccgaccgtcagccg
ctgccgcgcccggacctgcgccagtatcagcaggcgttagggccggtggcggtgtttggc
gccagcaactttccgttggccttttccaccgccggcggcgataccgcctcggcgctggcg
gctggctgcccggtagtggtgaaggcccatccgggccatatggccactgccgagctgacc
gctgaagcgatcgtccgggcggtagtgcggtgcggtttacccggcggcgtattcaatatg
attttcgggaccgatattggcgccgaattggtccgccatccggcgattcaggccgttggc
tttaccggttcgctggccggtggtaaggcgctgtatcagctggcgcagcagcgcccgcag
ccaatcccgctgtttgctgaaatgtcggcgattaacccattgattattctgccgcaggcg
ctgcagacgcgggccgaggcgctggcgaacgagctggtggcgtcattcaccctcggcggc
ggccagttctgtacccgtccggggttgattctggcgctgcgcggcgccgggctggaacgc
tttaagtcggcgctgtgcgcgacggtagcgggctcttcgccgcaggtgttgctcaatgcg
ccgacccttcagcactaccgccagggcgtggcggcgctggcggtgcacccgcgtatcgag
aagctggcgagcggcatcgctgccggcgccgggcaggcgcagaccctgctgtggcaggct
caggccgaggatctactggcgcaggatacgctgctgcagactgaggttttcggcccgtta
tcgctactggtggaagtggacgacatggcccagctgcaggcggtggtgaaagcgctgcag
gggcagctcaccgcgacgctgcatgccgaggcggatgatggcccgctggcggcgagcctg
ctaccgctgctttgcgaaaaagccggacgggtactgtttaacggttatcccaccggcgtg
gaagtgtgcgatgcgatggtccacggcggcccgtggccggcgaccaccgacgcgcgcggg
acctcggttggcagccgggcgattgaacgctttctgcgcccggtctgtctgcagaatgcg
cccgccgccctgttaccgccggcgctgcaggatgcgaaccctttgaacctgctgcgcctg
gtcaacggccagtggacccgggaagcgatttcttcctctcattga

DBGET integrated database retrieval system