KEGG   Kineococcus radiotolerans: Krad_4149
Entry
Krad_4149         CDS       T00562                                 
Name
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K02529  LacI family transcriptional regulator
Organism
kra  Kineococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:kra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kra03000]
    Krad_4149
Transcription factors [BR:kra03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Krad_4149
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_31
Other DBs
NCBI-ProteinID: ABS05612
UniProt: A6WFM3
Position
complement(2732094..2733095)
AA seq 333 aa
MTESVVPARIVDVAALAGVSAGTASKALNGTGQLRAETRERVRRAAEQLGFTPDPIGRGL
SSGRSYTVGLITTDSFGRFSIPILLGAENALGAGEMSVLLCDSRDDPLREQHYLRTLLAR
RVDGIIVTGRRTESRPPIAIPDHVPVVHAFTPSQDPADTSLTIDQAGGATAAVAHVLDLG
RRRVAHVTGPEDHHAAQVRRAAAEAAAGDALVGPSLHGDWSERWGRLAADLLLRRHPDLD
AVTCGSDQIARGICDGLRDAGRRVPEDVAVVGFDDWDVIALASRPPLTTVNLGLEALGRR
AGELLLGAVAGHPSPGTTTMPTRLVVRQSSVPA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgacggaaagcgttgttccggcgcggatcgtcgacgtcgccgcgctggccggggtctcc
gcgggcaccgcgtccaaggcgctcaacggcaccggccagctgcgggccgagacccgcgag
cgggtgcgccgggcggccgagcagctcggcttcacccccgaccccatcgggcgcgggctc
tcctccgggcgcagctacaccgtggggctcatcaccaccgacagcttcggccggttctcc
atccccatcctcctcggcgccgagaacgcgctgggggcgggcgagatgagcgtcctgctc
tgcgacagccgcgacgacccgctgcgcgagcagcactacctgcgcaccctgctcgcccgc
cgcgtcgacgggatcatcgtcaccggccggcgcaccgagtcccgcccgcccatcgccatc
cccgaccacgtccccgtcgtccacgccttcaccccctcccaggaccccgccgacacctcg
ctgaccatcgaccaggccggcggggcgaccgccgccgtcgcccacgtcctcgacctcggc
cgccgccgggtcgcccacgtcaccggccccgaggaccaccacgccgcccaggtgcgccgc
gccgccgccgaggccgccgccggcgacgcgctggtcggcccgagcctgcacggggactgg
agcgagcgctggggccggctcgccgcggacctgctgctgcgccgccaccccgacctcgac
gccgtgacctgcggcagcgaccagatcgcccgcgggatctgcgacggcctgcgcgacgcc
gggcgccgggtccccgaggacgtcgccgtcgtcggcttcgacgactgggacgtcatcgcc
ctggcctcccgccccccgctgaccacggtgaacctgggcctggaggcgctgggccggcgc
gcgggggagctgctgctgggcgccgtcgccggtcacccctcccccggcacgacgacgatg
cccacccggctggtggtgcggcagtccagcgtccccgcctga

DBGET integrated database retrieval system