KEGG   Kineococcus radiotolerans: Krad_1046Help
Entry
Krad_1046         CDS       T00562                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00900  Terpenoid backbone biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01130  Biosynthesis of antibiotics
Module
kra_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Krad_1046
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Krad_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Phage_TAC_11
Motif
Other DBs
NCBI-ProteinID: ABS02534
UniProt: A6W6U5
Position
complement(1223353..1224330)
Genome map
AA seq 325 aa AA seqDB search
MPGSPDPAPPELASVTARAPAKVNLLLQVGPRRDDGYHDLVTVFQAVSLHEEVTVTPADE
FGITVEGVGGTDVGGVPLDGTNLALRAARLLAERAGVDRAVHVHVRKEVPVAGGMAGGSA
DAAAALVACDSLWRLRLGLDALAELGAELGSDVPFGLHGRTAVGTGRGEHLVPVLTGASS
AWVFVLAEGGLSTPAVFAECDRRREATGHDAPPGRLEAVEAALRGGDVDALGAALSNDLQ
DAACALDPALAGTVAAGRRAGAVAGIVSGSGPTVALLARSPAAARRLALDLEPLFGAERL
RTATGPAPGARVLEAVSTPSPGGRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcagtcccgaccccgcgccccccgagctcgcctcggtcaccgcgcgcgccccc
gcgaaggtcaacctgctgctgcaggtgggcccccgacgcgacgacggctaccacgacctc
gtcaccgtcttccaggccgtctcgctgcacgaggaggtgaccgtcacccccgccgacgag
ttcgggatcaccgtcgagggggtcgggggcaccgacgtcggcggcgtcccgctggacggg
acgaacctggccctgcgcgccgcccggctgctcgccgagcgcgccggggtggaccgggcc
gtgcacgtgcacgtgcgcaaggaggtccccgtggccggcgggatggccggcggctccgcc
gacgccgccgccgccctcgtggcctgcgactccctgtggcgcctgcgcctgggcctggac
gccctcgccgagctgggcgccgagctgggctccgacgtccccttcggcctgcacgggcgc
accgcggtcggcaccgggcgcggcgagcacctcgtcccggtgctgaccggcgcctcctcc
gcgtgggtgttcgtcctcgccgagggcggcctctccaccccggccgtcttcgccgagtgc
gaccgccggcgcgaggccaccggccacgacgcgccgccgggacgcctggaggccgtcgag
gcggccctgcgcggcggggacgtcgacgccctcggcgcggcgttgtccaacgacctgcag
gacgccgcctgcgcgctggaccccgccctggccggcaccgtcgcggccgggcgccgcgcc
ggggccgtggccgggatcgtctccggctccgggcccaccgtcgccctgctcgcccgctcg
cccgccgcggcccgccgcctcgccctcgacctcgaacccctgttcggggccgagcggctg
cgcaccgccaccggaccggcccccggtgcccgggtcctcgaagccgtctccaccccgtct
cccggagggaggtcctga

DBGET integrated database retrieval system