KEGG   Kineococcus radiotolerans: Krad_1172Help
Entry
Krad_1172         CDS       T00562                                 

Definition
(GenBank) UvrD/REP helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
kra  Kineococcus radiotolerans
Pathway
kra03420  Nucleotide excision repair
kra03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:kra00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Krad_1172
   03430 Mismatch repair
    Krad_1172
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kra03400]
    Krad_1172
Enzymes [BR:kra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Krad_1172
DNA repair and recombination proteins [BR:kra03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Krad_1172
   MMR (mismatch exicision repair)
    Other MMR factors
     Krad_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 PDDEXK_1 UvrD_C_2 AAA_30
Motif
Other DBs
NCBI-ProteinID: ABS02660
UniProt: A6W771
Position
complement(1077515..1080901)
Genome map
AA seq 1128 aa AA seqDB search
MSARLSAVEIAQRLGRPTPTPEQVAVIEAPVEPVLVVAGAGSGKTETMSSRVVWLVANEL
VAPEDVLGLTFTRKAAGELAERVRRRLRGLRAVGLGPAPAPGAGADGPHGLGDGEPVVST
YHAYAASLVTDHGLRLGVEPQSTVLSDAGAWQLASDVVESWLGDLPGVEAAPSTLAAALV
QLAGECAEHLVDPGELVSFVDDLETRVRALPKDDRSVAKLGAHVPGEPYAKVRDLLAVQR
ARKAVVPLLEEYVRRKRDAEQLDFGDQVLLAARLAREVPAVAAGERARHRVVLLDEYQDT
SYAQLMLLRALFGAGHPVTAVGDPHQSIYGWRGASAGNLGRFPGHFPRADGTPAARLPLA
TSWRNDEAVLAAANLVAAPLNAAPGAGAVAVLRPRPGAGTGRVRAAFSATVEEEAAEVAA
RLAEVWRADSERLAVQRRVPGADPRPRRTAAVLCRKRSQFTVLQRALRDAGLPVEVVGLG
GLLTTPEVADVVATLHVLHDPARGDHLARLLTGARWRLGARDLAALGAWARHLQHRRAGL
PPDPHEPGEEPLVLPDEVEAVSLVEALDDLPGAGWSGPDGRSLSPRAHARLSRLAAVLRR
LRNRTHLPVPDLVGEVERALLLDVEVAARPGSSPASARANLDALADAAASFSAGSQRPGL
GGFLAWLDAAEVRERGLEQGASEVSTDAVQLLTVHASKGLEWDVVAVPGLVERTFPASGE
TDPGWLGGSGALGVLPYPLRGDREGLPRFDVEGAGTQKELDTARQRFLEACGQHQLAEER
RLAYVAFTRAKEELLLSGAHWDDAAKPREPSRFLREVLEAPRGAVPGLVVVPPAPAPEPG
APNPRTANPQRVVWPVDPLASRRVEVAAGAALVRAAMAERAAGGAAGPEAGGPEGGAVDE
ETAAWAEQSRLLLTERATAHDAPGVLLPAHLSASRLVTLAQDPDALALQLRRPVPQEPRP
ATRRGTAFHAWLEQRFTASSLLDLVDLPGSADEDAADDAELEALQRRFLASEWAARDPVA
VEVSVETPVADLVVRGRVDAVFAAVGADGRTRWDVVDWKTGRPPEGEAARARDVQLAVYR
LAWSRWRGVPLEDVSAAFFYASTGETVRPVDLLGAEDLERLVRSVPPA
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcccggctgagcgcggtcgagatcgcccagcgcctgggtcggcccacccccacg
cccgagcaggtcgccgtcatcgaggccccggtcgagccggtgctcgtcgtcgccggcgcg
ggatcgggcaagacggagacgatgtcctcgcgggtggtgtggctggtcgccaacgagctc
gtcgcccccgaggacgtgctggggctgaccttcacccgcaaggccgccggcgagctcgcc
gagcgcgtccgccgccgcctgcgcgggctgcgggcggtcgggctgggcccggcccccgcg
cccggggccggcgccgacggcccccacggtctcggtgacggggaacctgtggtgtcgacg
taccacgcctacgccgcctccctggtgaccgaccacggcctgcgcctgggcgtggagccg
cagtccacggtgctctccgacgccggggcctggcagctcgcctccgacgtcgtggagtcc
tggctgggggacctgcccggggtggaggccgcgccgagcacgctggccgccgcgctggtg
cagctggcgggggagtgcgccgagcacctcgtcgaccccggggagctggtctccttcgtc
gacgacctcgagacccgggtccgcgcgctgcccaaggacgaccgcagcgtcgccaagctc
ggggcccacgtcccgggggagccgtacgcgaaggtgcgcgacctgctggcggtgcagcgg
gcccggaaggcggtggtgccgctgctggaggagtacgtgcgccgcaagcgcgacgccgag
cagctcgacttcggcgaccaggtcctcctcgcggcccggctggcccgcgaggtccccgcg
gtcgcggcgggggagcgggcccggcaccgggtcgtcctgctcgacgagtaccaggacacc
tcctacgcgcagctgatgctgctgcgcgcgctgttcggcgccggccacccggtgacggcc
gtgggcgacccccaccagtccatctacggctggcgcggggcgagcgcgggcaacctcggg
cgcttccccgggcacttcccccgcgccgacggcaccccggccgcgcggctgccgctggcc
acgagctggcgcaacgacgaggcggtcctggccgccgccaacctcgtcgccgccccgctg
aacgccgccccgggggccggtgcggtcgccgtcctgcgcccccgcccgggggcgggcacg
ggccgggtccgcgcggccttctccgccaccgtcgaggaggaggccgccgaggtcgccgcg
cggctggcggaggtgtggcgcgcggactccgagcgcctcgccgtccagcgccgcgtcccc
ggcgccgacccccgcccccggcgcaccgcggccgtgctgtgccgcaagcgcagccagttc
acggtgctgcagcgggcgctgcgcgacgcggggctgcccgtcgaggtcgtcggcctgggc
gggttgctgaccaccccggaggtcgccgacgtcgtggcgaccctgcacgtcctgcacgac
ccggcccgcggcgaccacctcgcccggctgctcaccggggcccggtggcgcctgggggcg
cgcgacctcgccgcgctgggcgcctgggcccgccacctccagcaccggcgcgccgggctg
ccccccgacccgcacgaaccgggggaggagcccctcgtcctccccgacgaggtcgaggcc
gtgagcctcgtcgaggccctcgacgacctccccggggccgggtggagcggcccggacggc
cggagcctctccccccgggcgcacgcccggctgtcccggctggccgcggtgctgcgccgg
ctgcgcaaccgcacccacctgcccgtgccggacctggtcggggaggtcgagcgggctctg
ctgctcgacgtcgaggtcgcggcccgcccgggcagctccccggcctccgcccgcgccaac
ctcgacgccctcgccgacgccgcggcgtcgttctcggcggggtcgcagcgcccggggctg
ggcgggttcctggcctggctggatgccgcggaggtgcgcgagcggggtctggagcagggc
gcctccgaggtgtccacggacgccgtgcagctgctcaccgtgcacgccagcaagggcctg
gagtgggacgtcgtggccgtccccggcctggtggagaggacgttccccgcctccggcgag
accgaccccggctggctcggcgggtcgggcgcgctgggggtgctgccctacccgctgcgc
ggggaccgggagggcctgccgcgcttcgacgtcgagggcgccgggacccagaaggagctc
gacaccgcccgccagcgcttcctcgaggcgtgcgggcagcaccagctcgccgaggagcgg
cggctggcctacgtcgccttcacccgcgccaaggaggagctgctcctctccggtgcgcac
tgggacgacgcggcgaagccgcgcgaaccctcccggttcctgcgcgaggtcctcgaggcc
ccgcggggtgcggtccccggtctcgtcgtggtcccgcccgccccggcgccggaaccgggg
gctccgaacccgcgcaccgcgaacccgcagcgggtggtgtggccggtggacccgctggcc
tcgcgccgggtggaggtcgccgccggggccgccctggtccgggcggcgatggcggagcgg
gcggccggtggggcggctggccccgaggccggtggacccgagggcggggccgtggacgag
gagaccgcggcctgggccgagcagagccgcctgctcctcaccgagcgcgccaccgcgcac
gacgcgcccggggtgctgctgcccgcgcacctgtccgcctcgcggctggtgacgctggcc
caggaccccgacgcgctcgccctgcagctgcgccgcccggtgccgcaggagccgcggccc
gcgacccggcggggcaccgcgttccacgcctggctggagcagcgcttcaccgccagctcc
ctgctcgacctcgtcgacctacccgggtccgctgacgaggacgccgccgacgacgccgag
ctggaggccctgcagcgccggttcctggcctcggagtgggccgcgcgcgacccggtggcc
gtcgaggtgtcggtggagacccccgtcgcggacctcgtcgtgcgcgggcgcgtcgacgcc
gtcttcgccgccgtcggcgccgacgggcgcacccgctgggacgtcgtggactggaagacg
ggccggcccccggagggggaggcggcccgggcccgcgacgtgcagctcgcggtctaccgc
ctggcctggtcgcgctggcgcggggtgccgctggaggacgtcagcgcggcgttcttctac
gcctccacgggggagacggtgcgcccggtggacctcctcggcgcggaggacctggagcgg
ctggtgcggtcggtgccgccggcgtag

DBGET integrated database retrieval system