KEGG   Kineococcus radiotolerans: Krad_1176Help
Entry
Krad_1176         CDS       T00562                                 

Definition
(GenBank) NUDIX hydrolase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00760  Nicotinate and nicotinamide metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Krad_1176
Enzymes [BR:kra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     Krad_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX-like zf-NADH-PPase
Motif
Other DBs
NCBI-ProteinID: ABS02664
UniProt: A6W775
Position
complement(1074007..1074972)
Genome map
AA seq 321 aa AA seqDB search
MPLPSPPLRDLALSRQHLDRAGVNRVSPSRLAELWASPGTRVLQVHAGRAPVVSTPAGPR
LVLRAPAEVPAPGPDDLQLYLGVDDGVHHVAVVSPDAEPETTDGAGGGEEWRGLREVGEQ
LPARDAGLFTEALSMGNWHAVTRFSPRTGQPLVPASSGWVKVEPDGKEHFPRTDAAVIMA
VISPDDELLLGHQPVWPENRYSVLAGFVEPGECFEDTVRREAFEEAGIVVGSEPDDVRYL
GSQPWPFPASLMVGFAARAVTTDIKVDGDEIALARWFSRAQLAEELAAGRVLPPPGVSIA
RRLIEAWYGGPIPVPDERPWA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgcccctcccgagccctccgctgcgcgacctggcgctgtcccgccagcacctcgaccgg
gccggggtgaaccgggtctcgccctcgcggctggcggagctgtgggcctccccgggcacc
cgggtcctgcaggtccacgccgggcgcgcccccgtggtgagcacccccgcgggcccgcgg
ctggtcctgcgcgcccccgccgaggtccccgcgcccggcccggacgacctgcagctgtac
ctcggcgtggacgacggcgtgcaccacgtcgcggtcgtctcgcccgacgccgagcccgag
accaccgacggcgcgggcggcggcgaggagtggcgcgggctgcgcgaggtcggggagcag
ttgcccgcccgcgacgcggggctgttcaccgaggcgctgtcgatgggcaactggcacgcg
gtgacccggttctccccgcgcaccggtcagccgctggtcccggcctcgtcgggctgggtg
aaggtcgagcccgacggcaaggagcacttcccccgcaccgacgccgcggtcatcatggcc
gtgatctcccccgacgacgagctgctgctgggccaccagccggtgtggccggagaaccgc
tactcggtgctggcggggttcgtggagccgggggagtgcttcgaggacaccgtgcggcgc
gaggcgttcgaggaggccgggatcgtcgtcggctccgagcccgacgacgtgcgctacctg
ggcagccagccctggccgttcccggcgagcctcatggtggggttcgcagcgcgggcggtg
accaccgacatcaaggtcgacggcgacgagatcgccctcgcccgctggttcagccgggcg
cagctcgccgaggagctcgccgcgggccgggtcctgcccccgccgggggtgtccatcgcc
cgccgcctcatcgaggcctggtacggcggcccgatccccgtccccgacgagcggccctgg
gcctga

DBGET integrated database retrieval system