KEGG   Kineococcus radiotolerans: Krad_1181Help
Entry
Krad_1181         CDS       T00562                                 

Definition
(GenBank) transcription factor WhiB
  KO
K18958  WhiB family transcriptional regulator, redox-sensing transcriptional regulator
Organism
kra  Kineococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:kra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kra03000]
    Krad_1181
Transcription factors [BR:kra03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Krad_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Whib AT_hook
Motif
Other DBs
NCBI-ProteinID: ABS02669
UniProt: A6W780
Position
complement(1069903..1070283)
Genome map
AA seq 126 aa AA seqDB search
MTPQTPSQPTHPTRPGRGDRSSTRTAGDARNVAVTQEEVSGVTRRHTPDPLPCRRFDSEL
WFAEKPDDVELAKSLCQECPLLDACLAGALERNEPWGVWGGQLVLSGVVVPRKRPRGRPR
KHPVAA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcagaccccgtcccagcccacgcacccgacccgaccgggtcgaggggaccga
tcgagcacccgtaccgccggtgacgccaggaacgtcgccgtgacccaggaggaggtgagc
ggcgtgacccgccgccacacgccggacccgttgccctgccgccgattcgactccgagctc
tggttcgccgagaagcccgacgacgtcgagctcgccaagtcgctgtgccaggagtgcccg
ctcctcgacgcctgcctcgccggggcgctggagcgcaacgagccctggggggtgtggggc
ggccagctcgtcctctccggggtcgtcgtcccccgcaagcgtccgcgcggtcgcccgcgc
aagcaccccgtcgccgcgtga

DBGET integrated database retrieval system