KEGG   Kineococcus radiotolerans: Krad_1188Help
Entry
Krad_1188         CDS       T00562                                 

Definition
(GenBank) inner-membrane translocator
  KO
K10544  D-xylose transport system permease protein
Organism
kra  Kineococcus radiotolerans
Pathway
kra02010  ABC transporters
Module
kra_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:kra00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Krad_1188
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kra02000]
    Krad_1188
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    Krad_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ABS02676
UniProt: A6W787
Position
complement(1063952..1065301)
Genome map
AA seq 449 aa AA seqDB search
MSTTGHRPPQGPERATPEPAELTEQQRIAQLARATAGGGSALAQPAPEPTFREGVQAYLA
RLRGGDIGSLPAIAGLVVLFVLFSLLRPDTFPTAGNIANLLVQASSIIVLAMGLTFVLLL
GDIDLSAGVAGGASAAVMALVLRESGVNWVVGLLAALLTGLVLGTLIGLLVARVGIPSFV
VTLAFFLGVQGITLRLIGEGGTIAVRDDVIVAIANSNVPVWLGWVLTALAAAGYAAVSLG
RWAGQRRRGLSRDNLGVVIARLVVVVAVLFLVTAVLSQNRARVASIQLAGIPYSVPLIAV
LLVVLTLVLSRTRYGRHVYAVGGNPEAARRAGISVRGIRMSVFMIGSTLAALAGVIDASR
LNSVAPGSGGANTLLLGVGAAVIGGTSLFGGKGRVSNAVIGGLVIAAIANGLGLLGQAQY
VNYLVTGAVLLLAATVDAVSRRRRASSAV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccaccggacaccgtccgccccaggggcccgagcgggccacccccgagcccgcg
gaactcaccgagcagcagcgcatcgcccagctcgcccgcgccaccgccggcggcggcagc
gccctggcccagcccgcgccggaaccgaccttccgcgagggcgtccaggcctacctcgcc
cggctgcgcggcggggacatcggctcgctgcccgcgatcgccgggctggtcgtcctcttc
gtgctgttctccctgctgcgcccggacaccttccccaccgcgggcaacatcgccaacctc
ctcgtccaggcctcctcgatcatcgtgctcgcgatgggcctgaccttcgtgctgctgctc
ggcgacatcgacctgtccgccggcgtcgccggcggcgcctccgcggccgtgatggccctc
gtgctgcgcgagagcggcgtgaactgggtcgtcgggctgctggccgccctgctcaccggc
ctcgtgctgggcaccctgatcggcctgctggtcgcgcgggtcggcatcccgtccttcgtc
gtgaccctcgccttcttcctgggcgtgcagggcatcaccctgcgcctcatcggcgagggc
ggcaccatcgccgtgcgcgacgacgtcatcgtcgccatcgcgaactccaacgtcccggtg
tggctgggctgggtcctcaccgccctcgccgccgccggctacgccgccgtcagcctcggt
cggtgggccggtcaacgacgccgcgggctctcgcgcgacaatctcggcgtggtgatcgcc
cggctggtcgtggtcgtggccgtgctgttcctggtcaccgccgtcctgagccagaaccgg
gcgcgggtcgccagcatccagctcgccgggatcccgtactcggtgccgctcatcgcggtg
ctgctggtcgtgctgaccctggtgctcagccgcacccgctacggccgccacgtctacgcc
gtcggcggcaaccccgaggcggcccgccgggccggcatctcggtgcgcgggatccggatg
tcggtgttcatgatcggctccaccctggccgcgctggccggcgtcatcgacgcctcccgg
ctcaactcggtggcccccggctccggcggggcgaacaccctgctgctcggcgtcggcgcc
gccgtcatcggcggcacgagcctcttcggcggcaagggccgggtgtccaacgccgtcatc
ggcgggctcgtcatcgccgccatcgccaacggcctcggcctgctcgggcaggcgcagtac
gtcaactacctcgtcacgggcgcggtcctgctgctcgccgcgaccgtcgacgccgtctcg
cgccgccgtcgcgcctcctcggcggtctga

DBGET integrated database retrieval system