KEGG   Kineococcus radiotolerans: Krad_1190Help
Entry
Krad_1190         CDS       T00562                                 

Definition
(GenBank) conserved hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zincin_2
Motif
Other DBs
NCBI-ProteinID: ABS02678
UniProt: A6W789
Position
1061203..1062684
Genome map
AA seq 493 aa AA seqDB search
MEKTPDEQRGQPGFRPSGTPGRQDPAPGQGSGNPLEDLLGPLFGGQFPGGQFPGFPGGQF
PGFPGGVPQGIPGFGEAGFDPAVMGQVLGQLQKFLSTPSDAPVNWDVAHDLARQAAAKDG
DPTPNAVDRREVEDALRVADLWLDGTTDLAAAATTLEAWSRAEWVERTMPVWRQLVEPVA
TNVAAAMGDAMAAQAPPELAAVLGSAGAMLRQVGGGVFGMQVGQAIGQLAGEVLSTTDVG
LPLAPDGKAALVPENVRAFADGLEVPIDEVRRYLALREAAHQRLFTHVPWLRSHLLGSVE
SFARGISVDGERIAEAASQIDPANPESLQEALSSGIFEPESTPDQQAALARLETALALVE
GWVDHVTDEAARPVLPHAAALRETMRRRRATGGPAEHAFAVLVGLELRPRRAREATALWE
LLLARGGRSARDAVWDHPDLLPTAGDLDDATAFVERRLGSAGAPVQEEDAMDAALRDLLD
GGSGEGPGSTPQG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagacccccgacgagcagcgcgggcagccgggcttccggccctcgggcacgccg
ggtcggcaggaccccgcgcccgggcagggcagcggcaacccgctggaggacctgctcggt
cccctcttcggcgggcagttccccggcgggcagttccccggcttcccggggggccagttc
cccggcttccccggcggggtgccgcagggcatccccggcttcggcgaggccgggttcgac
ccggcggtcatgggccaggtgctggggcagctgcagaagttcctctccaccccctccgac
gccccggtgaactgggacgtcgcccacgacctggcccgccaggccgccgccaaggacggc
gaccccacgccgaacgcggtcgaccggcgcgaggtcgaggacgcgctgcgcgtggccgac
ctctggctggacggcacgaccgacctcgcggccgccgcgacgaccctggaggcctggagc
cgcgcggagtgggtcgagcggaccatgccggtctggcgccagctcgtggagccggtggcg
acgaacgtggccgcggccatgggcgacgcgatggccgcgcaggcccccccggagctggcc
gcggtgctcggctcggccggggcgatgctgcgccaggtcgggggcggggtgttcggcatg
caggtggggcaggccatcggccagctcgccggtgaggtcctctccaccaccgacgtcggg
ctgccgctggcgccggacggcaaggccgcgctggtgcccgagaacgtccgggccttcgcc
gacggcctcgaggtccccatcgacgaggtccgccgctacctggccctgcgcgaggccgcc
caccagcggctgttcacccacgtgccgtggctgcgcagccacctgctggggtcggtggag
tccttcgcccgcgggatcagcgtcgacggcgagcgcatcgccgaggccgcgagccagatc
gaccccgcgaacccggagtcgctgcaggaggccctgtcctcgggcatcttcgaacccgag
agcacccccgaccagcaggccgcgctggcccggctggagacggcgctggccctcgtcgag
gggtgggtggaccacgtcaccgacgaggccgcccgcccggtcctgccgcacgcggcggcg
ctgcgcgagacgatgcggcgccggcgcgcgacgggcgggccggccgagcacgccttcgcg
gtgctggtgggcctggagctgcgcccgcgccgggcccgcgaggccacggcgctgtgggag
ctgctgctggcccgcgggggccgcagcgcccgcgacgcggtgtgggaccacccggacctg
ctgcccaccgccggggacctcgacgacgcgacggcgttcgtcgagcgccggctggggagc
gccggggcgccggtgcaggaggaggacgcgatggacgccgccctgcgcgacctgctcgac
ggcgggtccggggagggtccggggagcaccccgcagggctga

DBGET integrated database retrieval system