KEGG   Kineococcus radiotolerans: Krad_1196Help
Entry
Krad_1196         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-ProteinID: ABS02684
UniProt: A6W795
Position
complement(1050797..1051432)
Genome map
AA seq 211 aa AA seqDB search
MDVVDVGAGTGGPYAVLAPAMALEGPVATFAGGALVGAGHAALVLVWLLAFGTDLVLDSA
LYLLGRAGRRAERHPRAARLTARLGLTARRRATWCRRVSDRLGSVVAGAKLVDVGAVPAF
LAAGYAGVGYRRFLGWTALLTALRVSVLVGLGVLTGQRLASRVEEVLDRPGLAVLGGLAL
AAVLLGAKALAGAALRAVRPGGGLRAASSPV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtggtggacgtgggagcggggacgggcgggccctacgcggtgctggccccggcg
atggccctggagggaccggtggcgacgttcgccggaggggccctcgtcggggccgggcac
gccgcgctggtcctggtgtggctgctggccttcggcacggacctggtgctcgacagcgcc
ctctacctgctgggccgggccgggcgccgggccgagcgccacccccgggccgcgcggctc
accgctcggctggggctcaccgcgcgacggcgcgcgacgtggtgccgccgggtctccgac
cgcctcgggtcggtcgtggccggggccaagctcgtcgacgtgggcgcggtgcccgccttc
ctcgccgccggctacgccggggtgggctaccggcgcttcctgggctggacggcgctgctg
accgcgctgcgggtcagcgtgctcgtcgggctcggcgtgctcaccgggcagcgcctcgcg
agccgggtcgaggaggtcctggaccggcccgggctggcggtgctcggcgggctcgcgctc
gccgcggtcctgctgggcgcgaaggccctcgcgggggcggccctgcgtgcggtccgtccg
gggggtgggctccgtgcggcgtcgtccccggtctga

DBGET integrated database retrieval system