KEGG   Kineococcus radiotolerans: Krad_1198Help
Entry
Krad_1198         CDS       T00562                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_24 HTH_10 Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: ABS02686
UniProt: A6W797
Position
complement(1048829..1049506)
Genome map
AA seq 225 aa AA seqDB search
MSSAPAVRAVVVDDQAMIRAGFSALLDAQPGVEVVGQAADGEEAVEVVTATTPDVVLMDV
RMPVLDGLEATRRILAAGLDPAPRVLVLTTFDVDDYVFSALQAGASGFLLKDATPEVLVD
SVRAVARGDSLLAPGITRRLIEHFVSTRRRAVDVPAALADLTPREREVLVCIARGLSNQE
IAAELFIAEQTTKTHVSRVLTKLGLRDRVQAVVLGYEIGLVSPGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccgcaccagccgtccgggccgtggtcgtcgacgaccaggcgatgatccgggcc
gggttctcggcgctgctggacgcccagcccggcgtcgaggtcgtcgggcaggccgccgac
ggggaggaggccgtcgaggtcgtcaccgcgaccacccccgacgtcgtgctcatggacgtc
cggatgcccgtcctcgacgggctggaggcgacccggcggatcctcgccgccgggctcgac
ccggccccgcgggtgctggtgctgacgaccttcgacgtcgacgactacgtgttctccgcc
ctgcaggccggggccagcgggttcctgctcaaggacgcgaccccggaggtcctggtcgac
tccgtccgcgccgtcgcccggggcgactcgctgctcgccccggggatcacccggcgcctc
atcgagcacttcgtctcgacccgccggcgcgcggtggacgtccccgccgccctggccgac
ctcaccccgcgcgagcgcgaggtcctggtctgcatcgcccgcgggctgtccaaccaggag
atcgccgcggagctgttcatcgccgagcagacgaccaagacgcacgtcagccgcgtcctc
accaagctggggctgcgcgaccgcgtccaggccgtcgtgctcggctacgagatcgggctg
gtcagccccggccggtga

DBGET integrated database retrieval system